KEGG   Cyprinus carpio (common carp): 109085754Help
Entry
109085754         CDS       T05134                                 

Definition
(RefSeq) serine/threonine-protein kinase Sgk3-like isoform X1
  KO
K13304  serum/glucocorticoid-regulated kinase 3 [EC:2.7.11.1]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109085754
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109085754
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109085754
Protein kinases [BR:ccar01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   109085754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Kinase-like APH Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 109085754
NCBI-ProteinID: XP_018955795
LinkDB All DBs
Position
Unknown
AA seq 227 aa AA seqDB search
MACALGYLHSLNIVYRDLKPENILLDSQGHIALTDFGLCKEGISQADTTTTFCGTPEYLA
PEVLRKQPYDNTVDWWCLGSVLYEMLYGLPPFYSRDTHEMYDNILHKELVMRPGASTAAW
SILQALLEKDNTRRLGYRDDFNEVKGHEFFSFINWDDLEQKKLPPPFSPSVESQYDISNF
DPEFTEETMPNSVCFSSGQSIVNASVMEADDAFVGFSYAPPSEDSFL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcatgtgctctgggttacttacactctcttaacattgtttacagggatttgaaacca
gaaaatatcctgctggactctcaaggacatatagccttgactgactttggactgtgtaag
gagggcatctctcaagcagacacaacaaccacattttgtgggacacctgagtatctagct
ccagaggtactcaggaaacaaccctatgataacactgtggactggtggtgtctgggttct
gtgctgtatgaaatgctttatgggctgcctccattctacagcagggacacgcatgagatg
tatgacaacattcttcacaaggaacttgtcatgcgccccggggcatccacagctgcctgg
tccatccttcaggccctgctggagaaagacaacaccaggaggcttggctacagagatgac
tttaatgaagtcaaaggacatgaatttttctcatttattaactgggatgaccttgaacag
aaaaagcttcctcctccattcagccctagtgtggaatcccagtatgacatctcaaatttt
gatcctgagttcacagaggaaaccatgccaaactctgtgtgcttctcttcggggcagtca
atcgtcaatgctagtgttatggaagctgatgatgccttcgtgggattttcttacgctccg
ccatcagaagattctttcctgtaa

DBGET integrated database retrieval system