KEGG   Cyprinus carpio (common carp): 109086196Help
Entry
109086196         CDS       T05134                                 

Definition
(RefSeq) DNA excision repair protein ERCC-1-like
  KO
K10849  DNA excision repair protein ERCC-1
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar03420  Nucleotide excision repair
ccar03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    109086196
   03460 Fanconi anemia pathway
    109086196
DNA repair and recombination proteins [BR:ccar03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     109086196
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HHH_5 Rad10 HHH HHH_2 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 109086196
NCBI-ProteinID: XP_018956216
LinkDB All DBs
Position
Unknown
AA seq 133 aa AA seqDB search
KDPHHALKELARICIMADCTLILVLECLNSVPIIKHICLCVSPEEAGRYLETYKSYEKKP
ADVLKEQVEKNYLSQVTDCLTTVKSVNKTDAMTLLSTFSSLEGIIKASKEELVLCPGLGP
QKARRLYDNTYLQ
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
aaagaccctcatcatgcactgaaagagcttgctcgaatatgcatcatggctgactgtacc
ctcattttggtcctggagtgcctcaattcagttcctataattaaacatatctgtttgtgt
gtaagtcctgaagaagcaggccgttaccttgagacatataaatcctacgagaaaaaacct
gcagatgttctgaaagaacaagtggagaaaaattacctgtcccaggttacagattgttta
accacagtgaagtctgtcaataagacagatgccatgactctcctgtctactttttcttct
ttggagggcatcattaaggcctctaaggaagaactggttttgtgtcctggacttggtcca
caaaaggcaagaaggctttatgacaacacttatttgcagtaa

DBGET integrated database retrieval system