KEGG   Cyprinus carpio (common carp): 109086797
Entry
109086797         CDS       T05134                                 

Definition
(RefSeq) uncharacterized protein LOC109086797
  KO
K05461  KIT ligand
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109086797
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109086797
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccar04052]
    109086797
Cytokines and growth factors [BR:ccar04052]
 Growth factors
  Growth factors (RTK binding)
   109086797
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 109086797
NCBI-ProteinID: XP_018956628
LinkDB
Position
Unknown
AA seq 248 aa
MFHMREVKIGESICLLVLLFSGLVTCSGVFGSPLTDDVATLDTLSENIPSDYRIPIRFIT
KDVGGACWLYVNLYHVESSLKTLALKFGNLSTNKVNITIFITMLEGFRFTLDNEELEVTM
QTFECHYRRGKWPTRRYFSHVKEVFTAAGSMCQSRQQYGMNGAIHGLLALFIIPSMALLV
LSVKIVFRRSCCCMQRMHEVSLNEPHDGAEESRTEPHSGAAQGDPDSSSSSQQDRAWVDS
LGCADTEV
NT seq 747 nt   +upstreamnt  +downstreamnt
atgttccacatgagggaggttaagattggagaaagcatttgtctattagtgttgcttttt
tctgggcttgtgacctgctcaggtgtttttggaagccctttaacagatgatgtggccacg
ttggacacactgagtgaaaacattcccagcgactacagaatacctatccgattcatcacc
aaggatgtgggtggagcttgctggctatatgtgaacctgtatcacgttgaaagcagttta
aaaacattggccctcaagtttggcaacctgtccaccaataaagtgaacatcactattttt
ataacaatgctggagggttttcgtttcactctggacaatgaggagctggaggtgacaatg
caaacattcgagtgccactatagaaggggaaagtggccgactagacgttactttagccat
gttaaagaggtttttacagcggctggatctatgtgtcaaagcagacagcagtatggtatg
aacggagcgattcacgggctcttggcgctgttcatcatcccaagcatggcacttctggtc
ctctctgtcaagatagtattcagaagaagctgctgttgtatgcaaagaatgcatgaagtc
agcttgaatgagccccacgacggagctgaagaaagcagaaccgagccccacagcggagct
gcgcaaggggaccctgattccagctctagcagccagcaggacagggcgtgggtggattct
ttagggtgtgcagacacagaggtttaa

DBGET integrated database retrieval system