KEGG   Cyprinus carpio (common carp): 109090165
Entry
109090165         CDS       T05134                                 

Definition
(RefSeq) adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00230  Purine metabolism
ccar01100  Metabolic pathways
ccar04020  Calcium signaling pathway
ccar04114  Oocyte meiosis
ccar04261  Adrenergic signaling in cardiomyocytes
ccar04270  Vascular smooth muscle contraction
ccar04371  Apelin signaling pathway
ccar04540  Gap junction
ccar04912  GnRH signaling pathway
ccar04914  Progesterone-mediated oocyte maturation
ccar04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109090165
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109090165
   04020 Calcium signaling pathway
    109090165
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109090165
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109090165
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    109090165
   04914 Progesterone-mediated oocyte maturation
    109090165
   04916 Melanogenesis
    109090165
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109090165
   04270 Vascular smooth muscle contraction
    109090165
Enzymes [BR:ccar01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109090165
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053
Other DBs
NCBI-GeneID: 109090165
NCBI-ProteinID: XP_018959547
LinkDB
Position
10
AA seq 1012 aa
MHRNRAFSEPEYSAEYSADCSVTLPSDPGQAVGRTHEVTVRSSGCCLCLPRFMRLTFAPD
SLENLYQTYFRRQRHETLLVLVVFAALFDCYIIVMCAVLYTGDKLASVAVASVGLAVDVL
LYLLCRFGLLPDRVTRRLVPYALWVLIAAQNFCYLGLNFARFHQPSDTVGWQAFFSFSFF
LTLPLRLTPIVLITAVSCGVHTLVLGVTIAQQQQEDIQGAALGRQLLANIVIYFCAITVG
VMSYYMADRKHRKAFLEARQSLEVKLNMEEQSQQQVRDTTRPNQHQRVEFNAGQSAPSPE
MRARLIFVSLFGAQCGKAFSLKLNKMLYFQKYHQLRIKILGDCYYCICGLPDYRDDHAAC
SIMMGLAMVEAISYVREKTQTDVDMRVGVHSGTVLGGVLGQKRWQYDVWSTDVTVANKME
AGGIPGRVHISQNTLECLHGEFDVEPGNGGDRCEYLKERGIETYLVVVPKGPVGKNGING
VKLSVTSSNGNSPLLINTTECNGSVHTACTTPEEPEELDTRVVNPSFPNPRRRLRLRDLA
ERVIDAQENEQELNKLLNEALLERETVQALKGKYTNRLSLRFTDPELETRFSVEKEKQSG
AAFSCSCVVLLFTAVMEALIDPWLVANYVTLAVGEVLLLILTICSLAAIFPRVFPKRLVS
FSTWIDHTRWARNTWAMAAIFIVTTADIVDMLSCRPPESSTSEVTAVTPVTPAASCCAEN
PKYYSYIAVLALIATTMLVQVSHMVKLTLMLLITGATGVVNIYSWRDIFDQYDLTRFKEY
RVHLVPSKYTMSVMIFIMMVSFYYFSRHVEKLARTLFLWKIEVHEQKEKVYEMRRWNEAL
VTNMLPDHVARHFLGSKKRDEELYSQSYDEIGVMFASIPNFSDFYTEESINNGGIECLRF
LNEIISDFDSLLDEPQFRCITKIKTIGSTYMAASGVTSDINTNGYACMKVREVVEDCYCI
LKDYGFRFVRRGPIFVKGKGELLTYFLKGREKQGSFINGSFVTLPHQVVDSS
NT seq 3039 nt   +upstreamnt  +downstreamnt
atgcaccggaaccgggccttttcagagcctgagtactctgcggagtattcggcggactgt
tcggtcaccctgccctcggaccccgggcaggcggtgggacgcacccacgaggtgactgtg
cgcagctccggctgctgcctgtgtctgccgcggttcatgcgcttgaccttcgcgccggac
tctctggagaacctctaccagacctacttccgccgtcagcggcacgagaccctgctggtg
ctggtggtgttcgcggccctcttcgactgctacatcattgtgatgtgtgctgtgctctac
actggcgataagctggcgtctgtggccgtggcgtcggtggggctggcggtggatgtcctg
ttgtacctgctgtgccggttcggtctgctcccggaccgtgtgacgcgccgcctggtgccc
tacgccttgtgggtgctcatagcggcccagaacttctgttacctaggactgaactttgcc
cgcttccatcagcccagcgacacggtgggctggcaggcattttttagcttttctttcttt
ctgacgctgccgctgcgtctgacccctatagtgctgatcacggccgtgtcctgcggcgtg
cacacgctcgtcctgggcgtcactattgcccagcagcagcaggaggacattcagggggcg
gctctgggaagacagttgctggccaacattgtgatctacttctgtgccatcactgtgggc
gtcatgtcgtattacatggccgaccgcaaacaccgcaaggcctttctggaggcgcggcag
tcgctggaggtgaagctcaacatggaggagcaaagccagcagcaggtgagagacacaacc
agaccaaaccaacaccagcgtgtggaatttaatgctggccaatcagctccttcaccagag
atgcgagcacgtctgatatttgtttcgctttttggtgctcagtgtggaaaggcctttagt
ctgaagcttaataagatgctctactttcagaaataccaccagttgaggatcaagatcctg
ggcgactgctattactgtatttgtggccttccagattaccgcgatgaccatgcggcctgc
tccatcatgatgggtttggccatggttgaggccatttcatacgttcgagagaagacgcag
acggacgtggacatgcgtgtcggggtgcattctgggacggttttgggaggcgtgctcgga
cagaagcgctggcagtatgacgtgtggtcgactgatgtgacggtggccaacaagatggag
gcaggagggataccagggcgagtgcacatctcccagaatacactggagtgtctgcatgga
gagtttgatgtggagccggggaacggaggagaccgctgcgagtacctgaaggaaaggggc
attgagacgtatttggtggtggtgcccaagggacctgtgggtaaaaacggcatcaacggg
gtaaagctttcagtgacgtcgtctaatgggaattctccattgctgatcaacactacggag
tgtaatgggagcgtccacacggcctgcaccacaccggaggagccggaggagctggacaca
cgggtggtgaacccctcgtttccaaaccctcggcgtcggttgcgtctgcgtgatctggcc
gagagagtcatcgacgctcaggagaacgagcaggagctcaacaaactcctcaatgaagct
ctgctggagagagagacagtacaggcgctgaaagggaagtacactaatcgtctgtctctg
cgctttactgatccggagctggagacgcgcttctcggtggagaaggagaagcagagcgga
gcggcgtttagctgctcttgtgtggtgctgctcttcaccgccgtcatggaggctctcatt
gacccctggttggttgcaaactatgtgactctggccgtaggtgaagtcttgctactcatt
cttactatctgttcgctggcagccattttccctcgggtatttccaaagcgattggtgtca
ttctctacttggattgatcacacgcgctgggctcgcaacacttgggccatggcagccatc
ttcatagtcacaacagccgacatagtagatatgttgagctgtcgtccaccagagtcctcc
acaagtgaggtgactgcggtcactccggtcactccggccgccagctgctgtgcagagaat
cctaaatactacagctacatcgcagtactggctctcatcgccaccaccatgctggtgcag
gtcagccacatggtcaaactcaccctcatgctgctgatcaccggagctacaggtgtggtc
aacatctacagctggagggacatctttgaccagtacgatctgacgcgctttaaagaatac
agagttcatcttgtgccctccaaatacaccatgagtgtgatgatcttcatcatgatggtc
agcttctactacttctcccgacatgtggagaagctggcacgcacactgttcctgtggaag
attgaagtgcatgagcagaaggagaaggtgtacgagatgcggcgctggaacgaggctctg
gtcactaatatgcttccggatcacgtcgcccggcatttcctgggctccaaaaagagggat
gaggaactctacagccagtcctacgatgagatcggagtcatgttcgcctccatcccaaac
ttctctgatttctatacggaggaaagcatcaacaacggagggattgagtgtctgaggttc
ctcaatgaaatcatttccgattttgatagccttttagacgagccacagtttcgctgtata
accaagatcaagactattggcagcacctacatggcagcatcaggagtcacttcagacatt
aacacgaacggttatgcttgtatgaaggtaagggaggtggtggaggactgctactgcatc
ctgaaggactacggcttccgcttcgtcaggagaggacccatattcgtcaagggcaaagga
gagctgctcacctacttcctaaagggacgtgaaaaacaaggctccttcattaacggctct
tttgtcaccctgccgcaccaagtggtggacagctcttga

DBGET integrated database retrieval system