KEGG   Cyprinus carpio (common carp): 109091017
Entry
109091017         CDS       T05134                                 

Definition
(RefSeq) protransforming growth factor alpha-like
  KO
K08774  transforming growth factor, alpha
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109091017
   04012 ErbB signaling pathway
    109091017
SSDB
Motif
Pfam: EGF Laminin_EGF
Other DBs
NCBI-GeneID: 109091017
NCBI-ProteinID: XP_018960372
LinkDB
Position
11
AA seq 140 aa
MYRAFWDTIFLLTEFIAAAVHSHFDDCPDSHSHFCFHGTCRFLILEETPACICHPGFVGM
RCEHADLLAVVASNHRQQTVATMLVLCVVGSVLLMLLCTLLNCWWRRGGCGRGNTISCWS
EKPRSILTGGTSCCHSETVV
NT seq 423 nt   +upstreamnt  +downstreamnt
atgtatcgtgctttttgggatacaatattccttctcaccgaatttatagcagccgctgtc
cactctcactttgatgactgccctgactcccatagccacttctgttttcatggcacatgc
cgctttctcatactggaggaaacacctgcatgcatatgtcatcctggctttgtgggtatg
cgatgtgaacatgcagacctcttggcagtggtggcatctaaccacaggcaacagactgtg
gccaccatgctggtgttgtgtgtggtgggcagtgttctactcatgctgctgtgcacttta
ctaaattgttggtggagacggggtggttgtgggcgaggtaacaccatttcgtgttggtcg
gagaagcctaggagtattttgacgggtgggacatcctgctgtcattcagaaacagtggtt
tga

DBGET integrated database retrieval system