KEGG   Cyprinus carpio (common carp): 109093191
Entry
109093191         CDS       T05134                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04068  FoxO signaling pathway
ccar04110  Cell cycle
ccar04115  p53 signaling pathway
ccar04218  Cellular senescence
ccar04310  Wnt signaling pathway
ccar04340  Hedgehog signaling pathway
ccar04371  Apelin signaling pathway
ccar04510  Focal adhesion
ccar04530  Tight junction
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109093191 (ccnd1)
   04340 Hedgehog signaling pathway
    109093191 (ccnd1)
   04371 Apelin signaling pathway
    109093191 (ccnd1)
   04068 FoxO signaling pathway
    109093191 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109093191 (ccnd1)
   04115 p53 signaling pathway
    109093191 (ccnd1)
   04218 Cellular senescence
    109093191 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109093191 (ccnd1)
   04530 Tight junction
    109093191 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C zf-C2H2_2
Other DBs
NCBI-GeneID: 109093191
NCBI-ProteinID: XP_018962458
LinkDB
Position
13
AA seq 292 aa
MEHQLFCCEVDTIRRAYQDSNLLNDRVLQTMLKAEEIYLPSPNYFKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPTKKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVRPSELLQMELLALNKLKWDLASVTPHDFIEHFLAKLPIHQSSKQILRK
HAQTFVALCATDVNFIASPPSMIAAGSVAAAVQGLYLKSSDSCLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHNISTETKRVEEDVDISCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacaccagttgttttgctgtgaagtggataccattagaagagcttaccaagatagc
aacctgttgaatgaccgagttttacagacaatgctcaaagcagaggaaatctatcttcca
tcgccaaattatttcaagtgtgttcagaaagaaattgtacctaaaatgaggaaaatcgtc
gccacatggatgctcgaggtctgcgaagagcagaaatgcgaagaggaagtctttccgctg
gctatgaactacctggacagatttttatctgtggagcccaccaaaaagaccagattacag
ctgttaggagcaacttgtatgtttttggcctctaaaatgaaagagactgtgccattaaca
gcagagaagttgtgcatatacacggacaactccgtccgtcccagcgaattattgcaaatg
gaactgctggcgctaaataaactgaagtgggatctggcctcagtgacaccacatgatttc
attgaacacttcctcgccaaactgcctatacatcagagctccaagcagatactacgcaag
cacgcccagacgtttgtggccctctgtgcaacagatgtcaacttcatcgcaagccctcca
tccatgattgcggccggcagcgttgcagcagcagtgcaggggttgtacctcaaaagcagc
gacagttgcctctcgtcccagaacctcaccaacttcctctcacaagtcatcagaagcgac
cctgactgtctgcgatcgtgtcaggaacagatcgagtccctgctggaatctagtctcaga
caagctcagcagcacaacatctccacagagaccaaaagagtggaggaggacgtggacatc
tcttgcactcccacagacgtcagagacattaatatctga

DBGET integrated database retrieval system