KEGG   Cyprinus carpio (common carp): 109094655
Entry
109094655         CDS       T05134                                 

Definition
(RefSeq) uncharacterized protein LOC109094655
  KO
K05461  KIT ligand
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109094655
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109094655
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccar04052]
    109094655
Cytokines and growth factors [BR:ccar04052]
 Growth factors
  Growth factors (RTK binding)
   109094655
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 109094655
NCBI-ProteinID: XP_018963920
LinkDB
Position
15
AA seq 257 aa
MFHMREVKIGESICVLVLLFSGLVTCSGVFGSPLTDDVATLETLSENIPSDYRIPIRFIT
KDVGGACWLYVNLYHVESSLKTLARKFGNLSTNKANITIFITMLEGFRFTLDNEELEVTM
QTFECHYRKGKWATRRYFNHVKEVLTAAGSMLGKFNDCTPPPCKTLPAPPFTPGQSRQQN
GMNGAIHGLLALLIIPSMVLLVLTLRMVFRRSHCCGQRMHEVSLNEPHDGAEESVTEPHS
RAAQGHPNSSSSSLQDR
NT seq 774 nt   +upstreamnt  +downstreamnt
atgttccacatgagggaggttaagattggagaaagcatttgtgtattagtgttgcttttt
tctgggcttgtgacttgctcaggtgtttttggaagccctttaacagatgatgttgccacg
ctggaaacactgagtgaaaacattcccagtgactacagaatacctatccgcttcatcacc
aaggatgtgggtggagcttgctggctttatgtgaacctgtatcatgttgaaagcagttta
aaaacattggcccgaaagtttggcaacctgtccaccaataaagcaaacatcactattttt
ataacaatgctggagggttttcgtttcactctggacaatgaggagctggaggtgacaatg
caaacattcgagtgccactacagaaagggaaagtgggcgactagacgttactttaaccat
gttaaagaggttcttacagcagctggatccatgcttggcaaatttaatgactgcacacct
cctccttgcaaaaccctgccagctcctcctttcacaccaggtcaaagcagacagcagaac
ggtatgaacggagcgattcatgggctcttggcgctgctcatcatccctagcatggtgctt
ctggtccttactctcaggatggtatttagaagaagccactgttgtgggcaaagaatgcat
gaagtcagcttgaatgagcctcacgacggagctgaagaaagcgttaccgagccccacagc
agagctgcgcaagggcaccctaattccagctctagcagcctacaggacaggtag

DBGET integrated database retrieval system