KEGG   Cyprinus carpio (common carp): 109095252Help
Entry
109095252         CDS       T05134                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04068  FoxO signaling pathway
ccar04110  Cell cycle
ccar04115  p53 signaling pathway
ccar04210  Apoptosis
ccar04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109095252
   04068 FoxO signaling pathway
    109095252
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109095252
   04210 Apoptosis
    109095252
   04115 p53 signaling pathway
    109095252
   04218 Cellular senescence
    109095252
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccar03036]
    109095252
Chromosome and associated proteins [BR:ccar03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109095252
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109095252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 109095252
NCBI-ProteinID: XP_018964481
LinkDB All DBs
Position
16
AA seq 159 aa AA seqDB search
MTFEELSGQDNAAATGDRMQSAGTALEELLVSAKKQDCLTVGVYESAQVMNVDPDSVAFC
VLATDEEYEWDIALQIHFTLIQAFCFDNDINIVRVNDIERLADIVGSDQDEEPKDVHCML
VTSPSADSWKDSALERLGLFCEESRNVYEWVPTITLPER
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacttttgaagaactgagtggacaagataacgcagctgctactggcgatagaatgcag
agtgcaggaacggctctagaggagcttctggtctccgctaagaagcaggactgccttacc
gttggggtgtatgaatctgcacaagttatgaatgttgacccagacagtgtggctttttgc
gtcctggctactgatgaggagtatgaatgggacatcgccttgcagatccacttcactctc
atccaagccttctgcttcgacaacgacatcaacattgttcgtgtgaatgacattgaacgt
cttgctgacattgtgggcagcgatcaggatgaggaacctaaggacgtacactgcatgctt
gtaacgagccccagtgctgactcgtggaaagattctgctcttgagagattgggcttgttc
tgtgaagaaagccgcaatgtctacgaatgggtgcctactattactctgccggagcgctga

DBGET integrated database retrieval system