KEGG   Cyprinus carpio (common carp): 109096024
Entry
109096024         CDS       T05134                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04060  Cytokine-cytokine receptor interaction
ccar04068  FoxO signaling pathway
ccar04144  Endocytosis
ccar04218  Cellular senescence
ccar04350  TGF-beta signaling pathway
ccar04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109096024
   04350 TGF-beta signaling pathway
    109096024
   04068 FoxO signaling pathway
    109096024
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109096024
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109096024
  09143 Cell growth and death
   04218 Cellular senescence
    109096024
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109096024
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109096024
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     109096024
Protein kinases [BR:ccar01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   109096024
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 109096024
NCBI-ProteinID: XP_018965245
LinkDB
Position
17
AA seq 548 aa
MSNCSLTSYCTLAEEVCVAIWRKDNVSVSVRTLCYNPQDMLENIMLTNYSSKECLMTPQH
SEDGLLFICGCIGEHECNDRLIFDKGVNGFSKLKSKDVIPVVVISLVPPLLVAVIATMAF
YLYRTRQLGKKPKDWGPRRTHYQSLDPAECQVNGSNYRSKLPSLSDDVNSEISSTCANNL
NHNTEQLPIQLEALVGKGRFAEVWRARLSHNEGGQYETVAVKIFPAVEYSSWCNERAIFS
DANLKHENIVQFLTAEERGGTAAAPQRQYWLIMAYYNMGNLQDFLTGHILTWTELCSLAG
SVARGLAHLHSDTTPCGTPKVPIAHRDLKSSNIVLKNHSECALCDFGLALRLDLSLTVDD
FANSGQVGTARYMAPEVLESRVNLEDLESFKQIDIYSMALVLWEMVSRCDVIGEVKSYEP
PFGSKVCEKPCIDSMRDLVLRDRGRPDIPASWTAHPGMQLVCATTTECWDHDPEARLTAH
CVVERFNTLAQEELENSICTHAPILPSTEAQSPSLPSLPPCTDHSTGIHPHFTSDTQISV
SSRQLSQM
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgagcaactgcagtctgacctcttactgtactctggctgaagaagtgtgtgtagcgata
tggaggaaggacaatgtgagcgtgagtgtgcggacactgtgttataaccctcaggatatg
ctggagaacataatgctgacaaactactcctccaaagagtgtttgatgacacctcagcac
tctgaagatggcctgctcttcatctgcggctgtatcggagaacatgagtgcaacgacagg
ctcatcttcgacaaaggagtcaatggattctcgaagctgaagtctaaagacgtcattcca
gtagtagtcataagcctggttccacccctcctggtagctgtcattgctacaatggctttt
tacctgtaccgaacacgtcagcttggcaagaaacccaaagactgggggccacgacgcacc
cactaccagtctctagatccagctgagtgccaagtaaatggtagcaattaccgcagcaag
ctgccgtccctcagcgatgacgtcaattcagaaatctcatcgacttgtgctaataaccta
aaccacaacacagagcagctgcccatccagttggaagcactggtgggtaaagggcgcttc
gcagaagtgtggcgtgcacggctcagtcataatgagggtgggcagtatgaaacggtggct
gtgaagatcttcccggcagtggagtattcctcatggtgtaacgaaagagccatattctct
gacgccaacttaaaacatgagaatatagtgcagttcctgactgctgaggagcgaggcggt
actgctgccgccccccagaggcaatactggctcatcatggcttattataacatgggcaac
cttcaggactttctgactggtcatatcctcacatggactgagctgtgttcactggcaggc
tctgtggcgagaggcctggcgcacctgcacagtgacacaacaccctgcggcacaccgaaa
gtgcccatcgcccatagagatctgaagagcagcaacattgtattgaagaaccacagcgag
tgtgcactctgtgatttcggactggctctacgactcgacctctcgcttactgtagatgac
tttgccaacagtggacaggtagggacagcacgctacatggcccctgaagttctggagtcc
agggtgaatttagaggacttagagtcctttaaacagattgatatctactccatggccctg
gtactgtgggaaatggtctcgaggtgtgacgtcataggagaggtaaagagttatgaaccc
ccatttggctcaaaggtgtgtgaaaaaccttgtattgacagcatgagagatctggtgtta
agagacagaggacgaccagatattccagcgagctggacagcacatccaggcatgcagctt
gtgtgtgcgactacaacagagtgctgggatcatgacccagaggctcgtctgacagcacac
tgcgtggtggaacgctttaatactctggcacaggaagagctggagaactccatctgcacc
cacgcacccatattgccatctacagaggcccaaagcccatcccttccctcccttcctccc
tgcacggaccacagcactggcatccatccgcattttacatctgacacgcagatctccgtt
tcctccaggcaactgagtcaaatgtga

DBGET integrated database retrieval system