KEGG   Cyprinus carpio (common carp): 109096098
Entry
109096098         CDS       T05134                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04110  Cell cycle
ccar04115  p53 signaling pathway
ccar04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109096098
   04068 FoxO signaling pathway
    109096098
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109096098
   04115 p53 signaling pathway
    109096098
   04218 Cellular senescence
    109096098
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 109096098
NCBI-ProteinID: XP_018965313
LinkDB
Position
17
AA seq 153 aa
MQLEVMEMHKRILQALGNGAARRTLFGPVDREQLQLEYRDALRKDLEEASRRWGFDFATE
TPLEGGDFLWEGVSGVKVPVLYRASQEEHPSRTGQSRAGKENVPRTPERYSVVPQNVEKT
PEKRTDLKRKQTNITDFYQAKKRVVATPRKSGQ
NT seq 462 nt   +upstreamnt  +downstreamnt
atgcagcttgaggtgatggagatgcacaagcggatcctgcaggctctcgggaacggtgcg
gcgcggcggaccctcttcggtccggtggatcgcgagcagctccagctggagtaccgcgat
gctctgaggaaggacctggaggaggcgtctcgccgctggggcttcgacttcgccaccgag
acgcctctggagggcggagacttcctgtgggagggcgtgtctggggtgaaggtgcctgtc
ttgtaccgcgcctctcaggaggagcatccgtcgaggaccggccagtcccgcgcggggaaa
gagaacgtccccagaaccccggagagatacagcgttgtcccgcagaatgtggagaaaacg
ccagaaaagaggaccgacctgaagaggaagcagaccaatatcacagacttctaccaggcg
aagaagagagtggtggctacaccccgcaaatcaggacaatga

DBGET integrated database retrieval system