KEGG   Cyprinus carpio (common carp): 109096195
Entry
109096195         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: erythropoietin-like
  KO
K05437  erythropoietin
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109096195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccar04052]
    109096195
Cytokines and growth factors [BR:ccar04052]
 Cytokines
  CSF and other factors
   109096195
SSDB
Motif
Pfam: EPO_TPO TssO LemA
Other DBs
NCBI-GeneID: 109096195
NCBI-ProteinID: XP_018965393
LinkDB
Position
2
AA seq 184 aa
MQITRLFALLLMVLEDPWTRPGLSSPLRPICDLRVLDHFIKEAWDAEAALRACKDACSIA
TNFTVPLTRVDFDVWEAMNIEEQAQEVQSGIHVLNEAISSLQASNQTDVLQSHIDASINN
IASIRQVLRSLSIPEYVPPTSDGEDKEMQKVSSISELFQVHINFLRGKVRLLLANAPVCH
QGVS
NT seq 555 nt   +upstreamnt  +downstreamnt
atgcagataaccagactctttgccttactgctgatggtgctggaggacccgtggacccgt
ccaggcctgtcctccccattacgccccatctgcgacctgcgtgtcctagaccatttcatt
aaggaggcatgggatgcggaggctgctttgagagcttgtaaggatgcctgcagcattgca
acaaacttcactgttcctctgaccagagtagattttgacgtctgggaagcgatgaatata
gaggagcaagctcaagaggtccagtcaggcatacatgtgctgaacgaggccatcagctca
ctacaggcatctaatcagactgatgtgctacagtcccacatagatgccagtattaacaac
attgccagcatcagacaagtgttgcgaagtctcagcataccggaatatgtacctccaacc
agtgatggagaagacaaagagatgcagaaagtatcctcgatctcagagctgtttcaggtc
cacatcaacttcctgcgtggaaaagtgcgtcttctgcttgccaatgcacctgtctgccat
caaggtgtcagctga

DBGET integrated database retrieval system