KEGG   Cyprinus carpio (common carp): 109097902Help
Entry
109097902         CDS       T05134                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109097902
Enzymes [BR:ccar01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109097902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 109097902
NCBI-ProteinID: XP_018967072
LinkDB All DBs
Position
20
AA seq 154 aa AA seqDB search
MAKKAVCVLKGTGEVTGTVYFEQESDGSPVKLSGEISGLTPGKHGFHVHAFGDNTNGCIS
AGPHFNPHNKTHGGPTDSDRHVGDLGNVIAGDNGVAKIDIVDAMVTLSGEYSVIGRTMVI
HEKEDDLGKGGNDESLKTGNAGGRLACGVIGITQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaggccgtttgtgtacttaaaggcaccggggaagtgactggcactgtttat
ttcgagcaagagagtgacgggtctccagtgaagctctcaggtgaaatcagtggccttact
ccaggaaagcatggtttccatgtccatgcttttggagacaacacaaacggctgcatcagt
gcaggtccgcacttcaaccctcataataaaactcacggtggaccaactgatagtgacaga
cacgtcggagatcttggtaacgtgatagctggtgacaatggtgttgcaaaaattgacatt
gtggatgcaatggtgaccctgtcaggggaatactcggtcattgggaggaccatggtgatc
cacgagaaagaggatgacttgggtaaaggaggcaatgacgaaagtcttaaaactggcaac
gctggaggtcgtctggcctgtggtgttataggcatcactcagtga

DBGET integrated database retrieval system