KEGG   Cyprinus carpio (common carp): 109097945
Entry
109097945         CDS       T05134                                 

Definition
(RefSeq) erythropoietin-like isoform X1
  KO
K05437  erythropoietin
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109097945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccar04052]
    109097945
Cytokines and growth factors [BR:ccar04052]
 Cytokines
  CSF and other factors
   109097945
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 109097945
NCBI-ProteinID: XP_018967111
LinkDB
Position
20
AA seq 186 aa
MQTFTGLVSVLLVFLWLGGNLVSPLRPICDLRVLDHFVREARDSEVIMRGCRGGCGAMKS
YFVPLTSVDFAVLEHMDVNGQAVEVQTGLSLLDQALNNAMKTVSNSPLANALDNNISNIH
SLGQILHSLDLQQARSTVLPDDSAPASTQTQEVSSLPELLQVQSSFLRGKVRLLLSAAPA
CQRQNS
NT seq 561 nt   +upstreamnt  +downstreamnt
atgcaaacgtttacaggtctggtgtcagttttgctagtgtttctgtggctgggtggaaac
ctggtctcgcccctccgacccatctgtgacctgagggttctggaccactttgtacgagaa
gctcgagattctgaggtcatcatgcgaggttgcagaggaggctgtggagcgatgaaatcc
tattttgttcctctgactagtgttgactttgctgttttggaacatatggatgttaatgga
caggccgtggaggtccagactggtttgtctctgctggatcaggccctgaataatgcgatg
aaaacagtgagcaactctcctctggccaatgcgctggataacaacatcagtaacatccac
agcctcggccagatcctgcacagtcttgatttacagcaggccaggtccacagttcttcca
gatgattcagctcctgccagcacacagacgcaggaggtctcctctctcccagaacttctg
caggtgcagagcagtttcctgcgagggaaagtcagactcctgctttcagctgcaccagcc
tgccaacggcaaaacagctga

DBGET integrated database retrieval system