KEGG   Cyprinus carpio (common carp): 109100494Help
Entry
109100494         CDS       T05134                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00480  Glutathione metabolism
ccar00980  Metabolism of xenobiotics by cytochrome P450
ccar00982  Drug metabolism - cytochrome P450
ccar00983  Drug metabolism - other enzymes
ccar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109100494
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    109100494
   00982 Drug metabolism - cytochrome P450
    109100494
   00983 Drug metabolism - other enzymes
    109100494
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccar02000]
    109100494
Enzymes [BR:ccar01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109100494
Transporters [BR:ccar02000]
 Other Transporters
  Pores ion channels [TC:1]
   109100494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 109100494
NCBI-ProteinID: XP_018969470
LinkDB All DBs
Position
25
AA seq 157 aa AA seqDB search
MAASQKCLGKGSPAPGLVPKDHIRLYSMRFCPFAQRTRLVLNAKGIKHDIVNINLKNKPD
WFLEKNPLGLVPTLETPSGQVIYESPITCEYLDEAYPEKKLLPSDPFERAQQKMLLEHFS
KVFPNSFHRILFIYIHFLALDSEILMGLLGSRGSQTY
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggcagcatctcagaaatgtcttggaaaaggaagccctgctcctggccttgtgccaaag
gaccatatacggctctacagcatgagattctgcccttttgcccaacggacaagactggtg
ctcaatgccaagggaattaaacatgacatcgtcaacatcaatttgaagaataagcctgat
tggtttctggagaagaatcctcttggtttagtgccaacgctggagaccccgagtggtcag
gtgatctacgagtcaccaatcacctgcgagtacctggatgaggcctaccctgagaagaaa
ctgctcccatctgacccttttgagagggcccaacagaaaatgctgctggagcatttctca
aaggtatttcccaactcattccacaggatattatttatatatatacactttttagcactg
gactcagagattttaatgggactgttgggctccagaggatcccagacttattga

DBGET integrated database retrieval system