KEGG   Cyprinus carpio (common carp): 109102359Help
Entry
109102359         CDS       T05134                                 

Definition
(RefSeq) mitogen-activated protein kinase 6-like
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109102359
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109102359
Protein kinases [BR:ccar01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109102359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 109102359
NCBI-ProteinID: XP_018971256
LinkDB All DBs
Position
28
AA seq 640 aa AA seqDB search
MAEKFESLMNIHGFDLGPRYMDLKPLGYGGNGLVFSAVDTDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFETLGPSGRRLMEDVSSLTEVNSVYIVQEYMETDLCKVLE
QGLLSEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRLELQSVIPVFIKNDMSEPHTPLAKLLPGVSPEALDFLEKILTFN
PMDRLTAEEALAHPYMSDYSFPLDEPVSLHPFHIEDEVDDILLMDESHSHIYNWDRYHES
QFSDQDWHLHSTHELEDVQRDPRAMSDVTDEEEVQIDPRKYMDGECEKFLEDPSFDLPLE
HSWQQEDHHENKYCDQECSYTCNYKAVSPSYLDNLIWRDSEVNHYYEPKLIIDLSNWKEQ
QSKEKNDKKGKTKCEKNGLVKAQIALQEASQNHCVAEKDREQEKHRNHSQGFDFDSFIAS
TIKMSLQPESGEVDLLNELNTSVSQLDSHSPCGFMSKSISQEKEEKCLVNLAQLGVRAPC
PWESFTDSDVTESSLIYEACWDVRKASSSRRRTTAARAVT
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagccttatgaacattcacggcttcgatcttggccctcgctac
atggacctaaagcctctgggctatgggggcaatggactggtcttttccgctgtcgacacc
gattgtgacaagagggttgctgtgaaaaagattgtcttaaccgacccccagagcgttaaa
cacgcattgcgcgaaatcaagatcatccgcaggctcgatcacgacaacatagtgaaggtg
tttgaaacgctagggcccagtggccggaggctcatggaggatgtgagctctctgacggag
gtcaactctgtgtacattgtacaggagtacatggaaaccgacctctgtaaagtactggaa
cagggcttgttgtccgaggatcacgcacggctgttcatgtaccaactgctgcgaggactc
aaatacatccactctgcaaacgtgcttcaccgtgacctgaagcctgccaacctcttcgtc
aacactgaagacttggtactgaaaatcggggactttggacttgcccgtataatggacccc
cactattcccataaggggcatctgtctgagggactggtcactaaatggtatcgttctcct
cgtctgctcctttccccaaataactacaccaaagccattgatatgtgggctgctgggtgc
atctttgctgaaatgctgactggaaaaacactctttgcaggtgctcacgagctggaacag
atgcagctgattctggaatccattccggtagtccatgaagaagacagactggagctccaa
agtgtaatacctgtctttatcaagaacgacatgtcagaaccacacacgccgcttgccaag
ttactgcctggtgtcagccctgaggccttggatttcctggagaagatcttgacatttaac
cccatggaccggctcactgcggaagaggctcttgcacacccatacatgagcgattactcc
ttccctctagatgaaccagtgtccttgcaccccttccacatcgaggatgaggtggatgac
atcttgctcatggatgagagtcacagtcacatctacaactgggacaggtaccatgaaagt
cagttctctgatcaagactggcacctgcacagcacccatgaactggaagacgtgcagcgt
gatcctcgtgctatgtcagatgtcacggacgaggaggaggtccagatcgatccacggaaa
tacatggatggggagtgtgagaagttcttagaagatccatcgttcgacctgcccctagag
cactcgtggcaacaggaagatcaccatgagaacaaatactgcgaccaggagtgcagttac
acttgcaactacaaagctgtgtctccatcctacctggacaatttgatctggagagacagt
gaggtgaaccactactatgagcccaaactcatcattgacctctccaactggaaagagcag
caaagcaaagagaagaatgacaaaaaaggcaagaccaagtgtgagaagaacggactggtc
aaggcccagatcgccctgcaagaggcatctcagaaccactgcgtggccgagaaggatcgc
gaacaggaaaaacaccggaaccacagccagggcttcgactttgactcgtttatcgccagc
accatcaaaatgagccttcagccagaatctggcgaagttgacctcctgaatgagttgaac
acctccgtttcccagctggactcccattctccttgcggcttcatgtccaagtccatcagt
caggaaaaagaagagaagtgtctagtgaacctggcacagctcggcgtccgagcaccctgt
ccttgggagagtttcacagacagcgacgttaccgagagcagcctaatctacgaggcttgc
tgggacgtccgcaaagcgagcagctccagaaggagaacaacagctgccagagcagttact
tag

DBGET integrated database retrieval system