KEGG   Cyprinus carpio (common carp): 109104295
Entry
109104295         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1C-like
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04020  Calcium signaling pathway
ccar04260  Cardiac muscle contraction
ccar04261  Adrenergic signaling in cardiomyocytes
ccar04270  Vascular smooth muscle contraction
ccar04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109104295
   04020 Calcium signaling pathway
    109104295
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    109104295
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109104295
   04261 Adrenergic signaling in cardiomyocytes
    109104295
   04270 Vascular smooth muscle contraction
    109104295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ccar04040]
    109104295
Ion channels [BR:ccar04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109104295
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF2670
Other DBs
NCBI-GeneID: 109104295
NCBI-ProteinID: XP_018973193
LinkDB
Position
30
AA seq 1844 aa
MCLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHRTLFFSKDGNKSPISE
EKPAPCAPNYAHGRHCTPANVTQCLMGWAGPNDGITNFDNFAFAMLTVFQCITMEGWTDV
LYWVNDAVGNSWPWLYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQ
QLEEDLKGYLDWITQAEDIDPENDDEGLDDDKPRNLSMPASENESVNTDNAPAGDMEGET
CCTRMARYSRRWNRLCRRTCRAAVKSNVFYWLVIFLVFLNTLTIASEHHQQPEWLTNVQE
IANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVEIKIMSPLGIS
VLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFNFPQ
SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD
NLADAESLTSAQKEEEEEKERKKLARTVSPEKRQDSEKPPLEEEKKEEKIELKSITSDGE
TPTATKINIDEYTGEENEEKNPYPVNDFPAGEEDDEEPEMPVGPRPRPLSDIQLKEKAVP
MPEAKAFFIFSPTNKVVPNCAVIHRSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCV
FVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCTDTSKQTQAECRGSYILYKDGNVG
KPEKAQRSWENSDFNFDNVLQGMMALFAVSTFEGWPRVLLYRAIDSHTEDVGPIYNYRVI
ISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRR
YIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQSQSFSKAMNILNMLFTGL
FTVEMILKLIAFKPRHYFVDAWNTFDALIVVGSVVDIAITEVNVSNLSLNMPHYFVDAWN
TFDALIVVGSVVDIAITEVNPADPSSSPPSSVVRPMGLQNTEDNARISITFFRLFRVMRL
VKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDQSQINRN
NNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSEVGHSSEVCGSHFAIIYFVSF
YMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVT
LLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLE
QANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGL
VAKIAPKTALSLQAGLRTLHDMGPEIRRAISGDLTVEEELERAMKETVCAASEDDIFRRS
GGLFGNHVNYYHQSDGHASFPQSFTTQRPLHISKSGSPGEAESPSHQKLVDSTFTPSSYS
SSGSNANINNANNTAIGHRYPKPTVSTVDGHTGPPLTTVPLPRPTWCFPNKRSCFYDTFM
RSDSSDSRLPIIRREEASTDETYDETFLDERDQTMLSMDMLEFQDEESKQLAPMEEADVG
EERKPWQSPRRRAFLCPTALGRRSSFHIECLRKHNRPDVSQKTALPLHLVHHQALAVAGL
SPLLRRSHSPTLFTRLCSTPPASPSGRGGGGPCYQPVPSLRLEGSGSYEKLNSSMPSVNC
SSWYSDSNGNHSRSVQRTQRPVSLIVPPVTRRDSTSLSHGSAGSLVEAVLISEGLGRYAQ
DPSFIQVAKQELADACDMTMEEMENAADNILNANAPPNANGNLLPFIQCRDTGSQESRCS
HVLGLSTTTGSDELLGADLERSEGAGQRNSTLMEDEDMECVTSL
NT seq 5535 nt   +upstreamnt  +downstreamnt
atgtgtttacaggtggtgctgaactccatcattaaagccatggttcccctcctgcacatc
gctctgctcgttctgttcgtcatcatcatttatgccatcattggcctcgagctgttcatg
ggcaagatgcacagaaccttgtttttctccaaagatggaaacaaaagtcctatatctgaa
gagaagccggccccctgcgccccaaactatgcccatggacgacattgcaccccggccaac
gtaacgcagtgcctgatgggatgggcgggcccaaatgatggaatcacgaactttgataac
tttgcatttgcaatgctgactgtgtttcaatgcatcacaatggagggctggactgacgtc
ctgtactgggtgaatgatgctgtagggaattcctggccatggctttattttgtcacttta
atcatcattggctccttttttgttcttaatttggttcttggggttttaagcggagagttc
tctaaagagcgagaaaaggccaaagctcgcggcgatttccagaagctccgtgagaagcag
cagctggaggaggatctaaagggctacctggactggatcacacaggcggaggatatcgac
cctgagaacgacgacgagggactggatgacgacaagcctagaaatctgagtatgccggcc
agtgaaaatgagtcagtgaacactgataatgctccagctggagacatggagggagagacc
tgctgtactcgcatggctcgatattcacgccgatggaatcggttatgtaggcgcacgtgc
cgtgcagcagtgaagtcaaatgtgttctactggctggtgattttcctggtttttttgaac
acacttactattgcctctgagcaccaccagcagccagaatggctcaccaatgtgcaagaa
atcgccaataaggtgttgctggctctttttactggtgagatgctgctgaagatgtacagt
ctgggcctacaggcctatttcgtctccctttttaaccgctttgacagttttgtggtgtgc
ggtggaattctggagactatcctggtggaaatcaagatcatgtcacccctcggcatctct
gtgctgcgctgtgtgcgtctgctccgcatcttcaagatcaccaggtactggaactctctc
agtaatctggtggcatctctgctgaactcggtacgttctatcgcgtccctgcttctgctg
ctcttcctgttcatcatcatcttcagtctgctcggaatgcagctctttaacttcccccag
tctctcctcaccgtctttcagattttgaccggagaggactggaactctgtgatgtatgat
gggatcatggcgtacggtggaccctcctttcctggcatgcttgtctgcatttatttcatc
atcctcttcatctgcggaaactacatccttctgaatgtcttcttggccattgccgtagac
aacctggcagatgccgagagtctgacatcagcgcagaaagaggaagaggaggagaaagag
aggaagaagctggccagaacggtcagtccagagaagcgtcaggactctgagaaaccacct
ctggaggaagaaaagaaagaggaaaagattgaactaaaatccatcacttctgatggagag
acgccaactgccactaagatcaacatcgatgagtacacaggggaggagaatgaggagaag
aatccatatcctgtgaacgatttcccagcaggagaggaggacgatgaggagccagagatg
ccagtaggtcctcgtccccgtccactctccgacattcagctgaaggagaaagctgtcccc
atgccagaagccaaagctttctttattttcagccccactaacaaggtggtgccaaactgt
gctgtgattcacaggtcaagtgccattaatgtagtgaagattctcagagtgctgagggtg
ttgaggcccctgagagcaatcaacagagccaagggcctcaaacatgtggtccagtgtgtg
tttgtagccatccgtaccatcgggaacatcgtcatcgtcaccactttgctgcagttcatg
tttgcctgtattggtgttcagcttttcaagggcaaattcttctactgcacagacacctct
aaacagacacaggccgaatgccgggggtcctatatattatacaaagacgggaatgttggg
aagccagagaaagcacagcgttcatgggagaacagtgacttcaactttgataatgtcctg
cagggcatgatggctctgtttgccgtgtccacttttgagggttggccgagggtgctcctc
tacagagccattgactcccatacagaggatgttggcccaatctacaactaccgtgtgatc
atctctatattcttcatcatctacatcatcatcatcgccttcttcatgatgaacatattc
gtaggtttcgtcattgtgacatttcaggagcagggagagcaagagtacaaaaactgtgag
ctggacaagaaccagcgccagtgtgtggaatatgccctgaaggcccgtcccctgcgcagg
tacatccctaagaacccgtatcagtacaaggtgtggtacgtggtgaactccacctacttt
gagtacctgatgttcaccctcatccttctcaacaccatctgcctggcaatgcagcatcat
ggccaatctcagtccttcagcaaagccatgaatatcctcaatatgttattcaccggcctc
ttcactgtggaaatgatcctcaaactcatcgccttcaaacccaggcattattttgttgat
gcatggaacacatttgatgcccttattgtagtgggtagtgttgttgatatagccatcaca
gaggttaacgtaagtaatctctctctcaatatgcctcattattttgttgatgcatggaac
acatttgatgcccttattgtagtgggtagtgttgttgatatagccatcacagaggttaac
ccagctgacccctcttcctctcccccctcctctgtggtaagaccaatgggcctccaaaac
actgaagataacgccaggatttcaatcacgttctttcggctgttccgcgtgatgaggctg
gtgaagcttctgtctcggggggagggcattcggacgctgctctggaccttcattaaatcc
tttcaggctcttccctatgttgctttgctgatcgtaatgctgttcttcatctacgccgtc
attgggatgcagatgtttggtaagattgccctgagggaccaaagccagatcaaccgaaac
aacaactttcagacgtttcctcaggctgttctgctgctcttcaggtgtgctacaggggag
gcatggcaggaaatcatgctggcctgttccccgaaccgcccatgtgagaaggggtcagag
gtcggccattccagtgaagtctgtggcagccactttgccatcatctactttgttagcttt
tatatgctttgcgccttcctgatcattaacctctttgtggccgtcatcatggacaacttt
gactatttaacacgtgattggtcgatactggggccgcatcacctagatgagtttaagagg
atatgggcagaatacgatcctgaggccaagggtcggataaagcacctggatgtggtgacg
ttactgcgcaggattcagcctccccttggatttggaaagctttgtccacatagagtggca
tgcaagcggcttgtgtccatgaacatgcctctcaatagtgacgggacggtgatgttcaac
gcaactctctttgctctagtacgaacagctctacgcatcaaaactgaaggtaacttggag
caagcaaatgaggaactccgagctattgtgaagaagatctggaagaggacaagcatgaag
ctgctggatcaagttgttccccctgctggagatgatgaagtaaccgttgggaagttctat
gccacattcctgattcaggaatacttcaggaaatttaagaagcgcaaggaacagggcctg
gtggccaaaattgccccaaagactgctctttcactgcaggctggcctgcgcacactgcat
gatatgggtcctgagatcagaagagcgatatcaggagacctgactgtggaggaggagctg
gagagagccatgaaggaaaccgtgtgtgctgcttctgaggatgatatcttcaggcggtct
ggcggcctcttcggtaaccacgtcaactactaccaccagagtgatggccacgcctccttc
ccacagtccttcacaacacagcggccattgcacatcagtaaatccgggagtcccggcgag
gcagaatctccctctcatcagaagctcgtcgactccaccttcactccgagcagttactct
tcctcaggatccaacgcaaacatcaacaacgccaacaacacagccattggacaccggtac
cccaaacctaccgtcagcacagtggacggacacacggggccgcccctcaccaccgtccca
ctaccacggcccacatggtgctttcctaacaagaggagctgtttctatgacactttcatg
cgctctgattccagtgacagtcgtctccctataatacggcgagaggaagcatctacagat
gagacgtacgatgaaacatttctagatgagagagatcagaccatgctctcaatggacatg
ctggaatttcaggatgaagagagcaagcaattggctccgatggaggaggcagatgtaggg
gaagagaggaagccgtggcagtctccacgaagacgggcattcctctgccccactgcactg
ggtcgacggtcttcctttcacatagaatgtctccgaaaacataacagacctgatgtttct
cagaaaacagcactaccactgcatctagtgcatcatcaggctttggctgtggcagggttg
agtcccttgctgagacggagtcattctccgacgctgttcacacgtctgtgctccacacct
cctgcgagtcccagtggccgcggcgggggagggccgtgctaccagcccgttccgtccctg
cggctggagggcagcggatcttacgagaaactcaacagcagcatgccgtctgtgaactgc
agctcgtggtacagcgacagtaacggcaaccacagcaggagtgtgcagaggacgcagcga
cccgtgtccctcatagttcctccggtcacacgcagagactccacatccctgtcacacggg
agcgccggcagcctcgtggaagccgtgttgatatccgagggtttgggtcgctatgcacag
gatccctccttcatccaggtagcgaagcaggaactagcggatgcctgcgacatgaccatg
gaggagatggagaacgccgccgacaacattctcaatgccaacgcaccgcccaacgccaat
ggaaacctgctacccttcatacagtgcagagacactggctcgcaggagtcccgttgcagc
catgtgctgggcctctcgaccaccacaggctccgacgagctgctgggggcggacctagag
cgctctgagggggcggggcagcggaacagcactctgatggaggacgaggacatggagtgc
gtgaccagtttgtag

DBGET integrated database retrieval system