KEGG   Cyprinus carpio (common carp): 109105949Help
Entry
109105949         CDS       T05134                                 

Definition
(RefSeq) trypsin-2-like isoform X1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ccar00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109105949
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     109105949
Peptidases [BR:ccar01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109105949
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109105949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 109105949
NCBI-ProteinID: XP_018974790
LinkDB All DBs
Position
32
AA seq 242 aa AA seqDB search
MRSLVFLVLLGAAFALDDDKIVGGYECTPHSQPWQVSLYSGYHFCGGSLISEYWVVSAAH
CYMSRLEVRLGEHNIAVNEGSEQFISSEKVIYHPNHDYWTLDSDIMLIKLSKPATLNQYV
QPVALPSGCAADGTMCRVTGWGNTMSSTADSNKLQCLEIPILSDRDCNNSYPGMITNTMF
CAGYLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAEKNHPGVYGKVCMFSQWIADTMK
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctttggtgttcctggtgctccttggagccgcctttgctctggatgatgacaag
attgttggtggatatgagtgcacaccccactcccagccctggcaggtgtctctgtactct
ggctaccacttctgcggtggctctctgatcagcgagtactgggttgtgtctgctgctcac
tgctacatgtcacgccttgaggttcgtttgggcgagcacaacatcgcagttaatgaggga
tctgagcagttcatctcctctgagaaggtcatctaccaccccaatcatgactactggacc
cttgacagtgacatcatgctgatcaagcttagcaagcccgctaccctcaatcagtacgtg
cagcctgtggccctgcccagtggctgtgccgccgatggcaccatgtgcagagttactggc
tggggaaacaccatgagttccactgctgattccaacaagcttcagtgtctggagatcccc
atcctgtccgaccgcgactgcaacaactcctaccctggtatgatcaccaataccatgttc
tgcgctggatacctggagggaggaaaggactcttgccagggtgactctggtggccctgtg
gtgtgtaacggtcagctgcagggtattgtgtcctggggttatggctgtgctgagaagaat
catcctggtgtctatggcaaggtctgcatgttcagccaatggattgctgataccatgaag
aacaactaa

DBGET integrated database retrieval system