KEGG   Cyprinus carpio (common carp): 109107245Help
Entry
109107245         CDS       T05134                                 

Definition
(RefSeq) pancreatic alpha-amylase-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00500  Starch and sucrose metabolism
ccar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109107245
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     109107245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 109107245
NCBI-ProteinID: XP_018976065
LinkDB All DBs
Position
33
AA seq 548 aa AA seqDB search
MQCSLLICRWLFSIHWTVFMTLRSLTLNCFPPDKGTMKLLILAALVGLCLAQHNPNTKHN
RTSIVQLFEWRWADIAEECERYLAPNGYGGVQISPPSESIVVSNPWQPWWQRYQPISYNL
CSRSGTEAELKDMITRCNNVGVNIYVDAVINHMCGAAGGEGTHSSCGSYFNANKKDFPSV
PYSSWDFNDDKCKTANEEIENYNEIFQVRDCRLVSLLDLALEKDYVRGKVAEYLNNLIDL
GVAGFRVDACKHMWPGDLTNVYGRLKTLNTTWFSPGTKPFIYQEVIDFGGEPIKASEYFE
LGRVTEFKYSTKLGTVIRKWNKEKLSYLRNWGEGWSFMPSDRAVVFVDNHDNQRGHGAGG
ASVLTFWDSRLYKIATGLMLAHPYGVTRVMSSYHWDRHFVNGKDQNDWMGPPSNANGSTK
PVPINPDSTCGDKWICEHRWRQIRNMVIYRNVVNDQPLSNWWDNGNNQIAFSRGSKGFIV
INNDDWALNVTLNTGLPKGTYCDIISGDKSGGSCTGKEVSVDADGRATFSISNTDEDPFI
AIHADSKL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgcagtctcttgatctgtagatggcttttcagcattcattggacggtgtttatg
acactgagatcactcaccctaaactgttttcctccggacaaaggcacaatgaagctcctg
attctggctgcacttgttggactgtgtcttgcccagcacaacccaaacactaaacataat
aggacctctattgttcagctgtttgagtggcggtgggcagatatagctgaagaatgtgag
agatacctggcaccgaatggctacggaggagttcagatctctccccccagtgagagtatt
gtagtgtccaatccttggcagccttggtggcagaggtatcaaccgatcagctacaacttg
tgctccagatcaggaacggaggcagagctgaaggacatgatcacacgctgtaataatgtt
ggggtgaacatatatgtggatgcagtgattaatcacatgtgtggagccgctggtggagag
ggcactcactccagctgtggatcatacttcaacgccaacaagaaggacttcccttctgtt
ccctactcatcatgggacttcaatgatgacaaatgtaaaactgccaatgaagagattgaa
aactacaatgagattttccaggtcagggattgtcgcttggtgagtctcctggatttggcg
ctggagaaagactatgttagaggaaaggtagctgaatatctgaacaatctgatcgatctg
ggtgtggctggattcagagtagatgcttgtaagcacatgtggcctggagaccttactaac
gtctacggcagactcaagaccctcaataccacttggttttctccaggcaccaagcccttc
atttatcaagaggtgatcgactttggtggggagcccattaaagccagtgaatattttgaa
cttggaagagtgacagagttcaaatatagtacaaaactgggcacagtcatccgtaaatgg
aacaaagaaaagctaagctatctcaggaactggggagagggctggagtttcatgccttct
gatagagctgtggtgtttgtggacaatcatgataatcagagaggccacggtgctggagga
gcttctgttctgacattctgggattctaggctttataagatcgctacagggctcatgttg
gctcatccatacggtgtgaccagagtcatgtctagctaccattgggatcgacattttgtg
aatggaaaggatcagaatgactggatgggccctccaagcaatgccaatggatccactaag
ccagtacccatcaacccagactccacctgtggggacaagtggatatgtgagcacagatgg
cgtcaaatcaggaatatggtgatttatcgtaatgttgtcaatgaccagcctctctccaac
tggtgggacaatggtaataatcagatcgctttcagccgcggcagcaaaggattcattgtc
atcaacaatgatgattgggcactaaatgtgacactgaacactggcctgcccaagggtaca
tactgtgacatcatctctggagataaaagtgggggcagttgcacagggaaagaggtgtca
gtggatgctgatggacgtgccaccttcagcatcagcaacacagacgaggatccattcatc
gccattcatgctgactccaaactgtag

DBGET integrated database retrieval system