KEGG   Cyprinus carpio (common carp): 109108030Help
Entry
109108030         CDS       T05134                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00562  Inositol phosphate metabolism
ccar01100  Metabolic pathways
ccar04068  FoxO signaling pathway
ccar04070  Phosphatidylinositol signaling system
ccar04115  p53 signaling pathway
ccar04140  Autophagy - animal
ccar04150  mTOR signaling pathway
ccar04218  Cellular senescence
ccar04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109108030
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109108030
   04070 Phosphatidylinositol signaling system
    109108030
   04150 mTOR signaling pathway
    109108030
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109108030
  09143 Cell growth and death
   04115 p53 signaling pathway
    109108030
   04218 Cellular senescence
    109108030
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109108030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccar01009]
    109108030
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109108030
    3.1.3.48  protein-tyrosine-phosphatase
     109108030
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     109108030
Protein phosphatases and associated proteins [BR:ccar01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    109108030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 PTEN_C2
Motif
Other DBs
NCBI-GeneID: 109108030
NCBI-ProteinID: XP_018976749
LinkDB All DBs
Position
34
AA seq 246 aa AA seqDB search
MAMAAKIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLD
SKHKHHYKIYNLCAERHYDASKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDESH
VAAIHCKAGKGRTGVMICAYLLHRRKFSEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYY
SYLLKNKLEYKPIALLFHKMVFQTLPMFSGGNCRDSTVKNRSEVNPQGFKKGNWHWGKMA
LLYYYS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggctgcaaaaattaaagaaatagtcagtcggaataagaggcgctaccaagaa
gatgggttcgatttggacttaacatacatctacccaaatatcattgccatgggattccct
gcagaacggttggagggagtttacagaaacaatatagatgatgtggttcgattcctagat
tcgaagcacaaacatcattataaaatttataatctatgtgctgaacgacactacgatgca
tccaaattcaattgtagggtggctcaatatccctttgaggaccataacccgccacagttg
gaattaataaagcccttctgcgaggatctcgaccaatggctgtctgaagatgagagccac
gtggcagccatccactgcaaggcaggcaaaggtcgcacgggggtcatgatatgcgcctac
ctgttgcatcgcaggaagttctcagaggcacaagaagcactggacttttatggggaagtc
aggaccagggataaaaagggggtcaccattcccagccagcgcaggtatgtgtattactac
agctacctgctgaagaacaagctggaatataaacccattgctctcctcttccataaaatg
gtattccagactctgccgatgttcagtgggggaaactgcagggacagtactgtaaaaaac
aggagtgaggtgaatccccagggcttcaagaaaggcaactggcactggggtaaaatggca
ttactttactactactcttaa

DBGET integrated database retrieval system