KEGG   Cyprinus carpio (common carp): 109108561Help
Entry
109108561         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar03030  DNA replication
ccar03410  Base excision repair
ccar03420  Nucleotide excision repair
ccar03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    109108561
   03410 Base excision repair
    109108561
   03420 Nucleotide excision repair
    109108561
   03430 Mismatch repair
    109108561
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ccar03032]
    109108561
   03400 DNA repair and recombination proteins [BR:ccar03400]
    109108561
Enzymes [BR:ccar01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109108561
    6.5.1.6  DNA ligase (ATP or NAD+)
     109108561
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     109108561
DNA replication proteins [BR:ccar03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    109108561
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     109108561
DNA repair and recombination proteins [BR:ccar03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     109108561
   NER (nucleotide excision repair)
    Other NER factors
     109108561
   MMR (mismatch excision repair)
    Other MMR factors
     109108561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 109108561
NCBI-ProteinID: XP_018977238
LinkDB All DBs
Position
4
AA seq 1033 aa AA seqDB search
MQRSIASFFQPMKSKEKSDGQVKTKSEPVKSPLKIQNGVQESDSPVKKVHKRSRAIIDSD
DEDQQIVKEQVPKHSEVEPVKPEQKSGVTKAASTPVSPKTPITPRTPVTSSTSVAVVTPA
SSGTPGTPATPTSTSPSGIPKRKTARKQFPKRKLDSRSDGEGAKEEEKEVDEGQESKRAR
VEASPGQTDNEMMEVEEKSTDGKTAAEEQKEKDEAKTTVAEDNANNKMKEKEKNKVKQEK
KINGENGKKEKKDKKEKEHCSPERAVKKEKSEEEEGGSAKKKPISSLFCFYNEMMEEKKI
NGENGKKKKKNKKEKEHCSPERAVKKEKSEEEEGGSAKKKPISSFFAPRKAAVKLEKEER
NEGEKRKDGEISDATEPKEKKSEKGVDSAVQSQYDPSRAHYHPVDHACWKKGQKVPYLAV
ARTFERIEEDSGRLKNIETLSXLLRSVILLSPDDLLCCVYLCLNQLGPAYQGLELGIGET
ILMKAVAQATGRQLDKIKAEAQEKGDLGLVAESSRSNQRMMFAPANLTAGGVFNKLKEIA
NMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGLAEQSVLTALSQAVCLSPP
GQEFPPAVLDAGKGMSAENRRVWLEEKALILKQTYCEMPNYDAIIPVLMKEGIDELPNHC
KLTPGVPLRPMLAHPTKGVGEVMKRFDEASFTCEYKYDGERAQIHILENGEVRIFSRNQE
DNTSKYPDIISRIPQVKKENVRSCVLDSEAVAWDREKKQIQSFQVLTTRKRKDVDASEIK
VQVCVYAFDLLYLNGESLVREPLSKRRALLRESFEEKEGEFVFARSLDSDNTESIAEFLE
QSVRDSCEGLMVKTLEKHATYEIAKRSHNWLKVLHTTVCLCSYQTAGTKGTLKYILYECH
VLVMYLFVYFCQIGTGFKDEDLEQHYSFLKEHILPKPRPYYRVDQSAEPDVWLEAVQVWE
VKCADLSLSPVYKAAMGLVDPEKGISLRFPRYLRIRDDKKPEDATTGSQIADLYKKQQQI
QNQGEKQDLEDYY
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcatagcgtcattctttcagccaatgaaaagtaaggagaagagtgatgga
caggtcaaaacaaagtctgaacctgtaaaaagtcccctcaaaattcagaatggtgtgcag
gaaagtgattcaccagtaaagaaggtgcataaacgcagccgagcaatcatagacagcgat
gatgaagatcagcagatagtaaaagagcaggtgccaaaacacagtgaagttgaaccagta
aagccagagcagaaatctggtgttacaaaggctgcttccacgccggtttctccaaaaact
cctataaccccgaggactccggtcacgtcgagtacctctgttgcggtggtaacccctgct
tcctcaggtactccgggaaccccagcaactccgacatcaacatcgccgtcaggcattccc
aaacgcaagaccgcccgcaagcagttccccaagaggaagctggacagcagaagtgatgga
gagggggcaaaagaggaggagaaggaggtcgacgaagggcaggagagtaagagagcacga
gttgaggcctcacctggacagacagacaacgagatgatggaggtggaagagaagagcaca
gatgggaagactgcagcggaggaacagaaagagaaggatgaagctaaaacaaccgtagct
gaggacaatgcaaacaataagatgaaagaaaaggagaaaaataaggtaaaacaggagaaa
aagatcaatggagaaaatgggaagaaagaaaaaaaagacaagaaggaaaaggaacactgc
agtcctgaacgagcggttaaaaaagaaaaaagcgaagaagaggaaggtggatcggccaaa
aagaaacccatcagcagtcttttttgtttttataacgagatgatggaggagaaaaagatc
aatggagaaaatgggaagaagaaaaaaaagaacaagaaggaaaaggaacactgcagtcct
gaacgagcggttaaaaaagaaaaaagcgaagaagaggaaggtggatcggccaaaaagaaa
cccatcagcagcttttttgctcccagaaaggcagctgtcaaactagaaaaagaggagcga
aatgagggagagaaaaggaaggatggagagatctctgatgctactgaaccgaaagagaag
aaaagtgaaaagggggtggattctgcagtccagagccagtatgatccctccagagcacat
taccatccagttgaccacgcctgctggaagaagggccaaaaagtgccatatttggctgtt
gctcgcacctttgagaggattgaagaggattcgggcaggctgaagaacattgaaacgctt
tcctaacttttgcgatctgtaattctgctttctccagatgacctgttatgctgtgtgtac
ctgtgtctgaatcagctcggccctgcatatcagggtctggagttgggcattggggagacc
atcctgatgaaagctgtcgctcaagcaactgggcgacaactggacaaaatcaaggcggag
gctcaggagaaaggtgacctgggattggttgctgaaagttctcgtagcaaccagagaatg
atgtttgcaccggccaatctgacagcagggggcgttttcaacaaactgaaagagattgct
aacatgagtggaaattctgcaatgaataagaagattgacattattaaaggcttgtttgtg
gcatgtcggttttctgaggctcgatacattgtgcggtcactggctgggaagctgcggatt
ggattggctgagcagagcgttctcacggctctcagtcaggctgtgtgtctgtcgcccccg
ggccaagagttcccaccagctgtgttggatgcagggaaaggaatgagtgcagaaaacagg
agagtgtggctggaggagaaagcactgatcctaaaacagacatactgtgagatgccaaat
tatgatgcaatcattcctgtattgatgaaggagggcatagatgaactgcctaatcactgc
aagctcaccccaggtgtgcccctgcggcccatgttggctcacccgactaaaggggttggt
gaggtaatgaaacgtttcgatgaggcatctttcacctgcgagtataaatatgatggcgag
agagcccagatccatattcttgagaatggagaggtgcgcatttttagccgaaaccaagaa
gacaacacaagcaaataccctgatattatttcacgaatcccacaggtgaagaaagagaac
gtacggtcctgtgttttggattcagaggcggttgcctgggacagagaaaagaaacagatc
cagtcatttcaggtccttaccacaaggaagagaaaggatgtggatgcatctgagatcaag
gttcaggtgtgtgtgtacgcatttgatttgctgtacctcaatggagagtctctggtgcga
gagcctctaagcaaacgtagggctctgttacgggagagttttgaggagaaagaaggagag
tttgtttttgctcgatctctggactctgacaacacagagagcattgctgagttcctggag
cagtctgtacgagattcttgtgaaggcctaatggtgaagacattggaaaaacatgcaact
tatgagattgccaaacgctcccacaactggctcaaggtattgcacaccacagtgtgttta
tgttcatatcagactgcaggaacaaaaggaacgttaaagtatatattatacgagtgtcat
gttcttgtcatgtatttgtttgtttatttttgtcagattggaaccggcttcaaagatgaa
gatctggagcaacattacagtttcttaaaggagcacatcttacctaaaccacgtccatat
taccgtgtggaccaatcagcagagccggatgtctggctggaggcggtgcaagtgtgggag
gtgaaatgcgctgacctttcactgtctcctgtctacaaggcagcgatgggattggtggac
ccagagaaaggcatttcacttcgtttcccacggtacctcaggataagagatgacaaaaag
ccagaggacgccaccacagggtcacagattgcagatctttacaagaaacagcagcagatt
caaaatcagggtgaaaaacaagatctggaggactactattga

DBGET integrated database retrieval system