KEGG   Cyprinus carpio (common carp): 109109341
Entry
109109341         CDS       T05134                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109109341
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109109341
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ccar03310]
    109109341
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    109109341
Nuclear receptors [BR:ccar03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   109109341
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 109109341
NCBI-ProteinID: XP_018978048
LinkDB
Position
1
AA seq 745 aa
MDQGGLKNGAKRDDHLNTLDYSNSPVEGILRSGIQSAMSVAPTSLVPQPNPLMQPVSGDV
PNGLSNSPTLEEHTTSVSSTLGIFGEDSELKMVGKEQRAHQHQTLGAFTLGDSFSSLEAS
IADLNSTSPSVDSLIGGVDPNLFPLKTEDFSLMDKGDMDLDQDSFGPIGKDGDVDNHKLF
SDNTLDLLQDFELDGSPSDFYGADDPFLSTISEDALLGDLPTITERDSKVAVNGATTTPS
TSGINTVTVSLPTVKVEKDSIIQLCTPGVIKQENNGGTKYCQASLHSTPINICGVTTSSG
QSFLIGTSPSTAAVSQQKDQKPVFNVYTPVTSSEDGWGRGYGFGNASEMQQRASESFSKN
YTSPYARPEDSTATSSAAGKSGTHKSCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHN
YLCAGRNDCIIDKIRRKNCPACRYRKCLMAGMSLEARKNKRGRQTGKVIQQPSIPERSLP
PLPEVQALVPKPMPQVVPTMLSLLKAIEPDTIYAGYDSTIPDTSTRLMTTLNRLGGRQVI
SAVKWAKALPGFRNLDLDDQMTLLQCSWLFLMSFGLGWRSYQQCNGNMLCFAPDLVINEE
RMRLPYMNDQCEQMLKISNEFVRLQVSNEEYLCMKVLLLLSTVPKDGLKSQSVFEELRMS
YIKELGKAIVKREENSSKNWQRFYQLTKLLDSMHDMVGGLLNFCFYTFVNKSLSVEFPEM
LAEIISNQLPKFKAGSVKPLLFHQK
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggatcaaggaggactgaagaatggcgccaagagagatgatcatttgaatacgttggat
tacagcaacagcccggtcgagggaattttacgaagcgggatacaaagcgccatgtctgtc
gcccccacctcgctggttcctcagcccaatccgctgatgcaaccggtttccggggacgtt
cccaatggcttgagcaactcgcccactctggaggagcacaccacctccgtgtcctccacc
ctcggcatctttggggaagattcagagctcaaaatggttgggaaggagcagagggcccat
caacaccaaaccctgggcgctttcacgttgggagacagcttctcaagtctggaggccagc
atcgcagacctcaacagcacttccccttcagtggactccctgattggtggcgtcgacccc
aatctctttcctttaaaaacagaggatttttccctcatggataaaggcgatatggacctt
gaccaagattccttcgggcccattgggaaagatggcgacgttgacaatcataagctcttt
agtgacaacactctggaccttctgcaggacttcgagttggacggatcgccctccgatttc
tacggggcggatgacccgttcctctccaccattagtgaagatgctttgcttggagacttg
ccgacaattacagagagggactcgaaggttgcggtcaatggcgcgactaccactcccagc
acctccggcatcaacacggtcaccgtcagcttgcccaccgtgaaggtggagaaggactct
ataatccagctgtgcactcctggggtcatcaaacaggagaacaacggtgggactaaatac
tgtcaggcgagtctgcacagcacacccattaacatctgcggcgtcaccacttcaagtgga
cagagcttcctaatcgggaccagcccatccacagctgctgtcagtcagcagaaagatcag
aagcccgtctttaacgtgtacacccctgtgacctcttcagaagacggttggggcaggggc
tatggctttgggaatgcaagtgaaatgcagcagagggccagcgaaagtttttccaaaaac
tacacaagcccctatgccagacctgaagacagcactgccacatcctcggctgctgggaag
tccggcacacataagagctgtcttgtgtgctccgatgaagcttcaggctgccattatgga
gtcctcacctgcggaagctgtaaagtcttctttaagagagcagttgaagggcaacacaat
tacctgtgcgctggacggaacgattgcatcattgacaaaatccgccggaagaactgccct
gcctgtcgttaccgcaaatgcctcatggcaggcatgagcctagaggcccgtaaaaacaag
aggggccgtcaaaccggcaaggttatccagcagccgtcgattccagagcgcagtcttcct
ccgctgcccgaagtccaggcactggtgcccaaacccatgccccaggtggtgcccaccatg
ctgtcactgctaaaggccatcgagccggacaccatctacgccggatacgacagcaccata
cctgacacctccacccgcctcatgaccactctgaaccggctgggcggccggcaggtcatc
tctgcggtcaaatgggccaaagctctgccagggttccggaaccttgacctggatgatcag
atgaccctcctgcaatgttcctggctgttcctcatgtccttcggactcggttggaggtca
taccagcagtgtaatggaaacatgctgtgtttcgcaccagacctggtcatcaatgaagag
aggatgaggttgccctacatgaatgatcagtgtgaacagatgctgaagatctccaatgag
tttgtgagactgcaagtgtccaacgaggagtacctgtgcatgaaagtccttctgctcctg
agcacagtgccgaaggatggtttgaagagccagtcagtgtttgaagagctacgaatgtct
tacattaaagaactgggcaaggccatagtgaagagagaggagaactccagcaagaactgg
caacgattctatcagctcactaagctactggactccatgcacgacatggtgggtggactc
ctgaacttctgtttctacacctttgtgaataaatccctcagcgtggagtttcccgaaatg
ctggcggagatcatcagcaaccagttaccaaaattcaaagctgggagtgtcaaaccgctg
ctctttcaccagaagtga

DBGET integrated database retrieval system