KEGG   Cyprinus carpio (common carp): 109109517
Entry
109109517         CDS       T05134                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109109517 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109109517 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccar04052]
    109109517 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:ccar00536]
    109109517 (fgf1)
Cytokines and growth factors [BR:ccar04052]
 Growth factors
  Growth factors (RTK binding)
   109109517 (fgf1)
Glycosaminoglycan binding proteins [BR:ccar00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   109109517 (fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 109109517
NCBI-ProteinID: XP_018978196
UniProt: A0A059T9K9
LinkDB
Position
1
AA seq 147 aa
MTEAGPAEKLGPHDYKKLARLYCMNGGFHLRLAADGTVAGAREEDEYSILRIKATSPGVV
VIEGAETGLYLSMNEDGKLYASSCVTDESYFLERMEENHYNTYQSQKHGENWYVGIKKNG
KMKRGPRTHIGQKAIFFLPRQVDQTKD
NT seq 444 nt   +upstreamnt  +downstreamnt
atgacggaggccggtcctgcggagaaactcggccctcacgattacaagaagctggcgcgg
ctgtactgcatgaacggagggtttcacctgcggctcgcggcggacggaaccgtggcgggt
gcgcgagaggaagacgaatacagcatactgcgcataaaagctactagtccaggagtggtg
gtcattgaaggagcagagacaggactttacctctctatgaatgaagacggcaagctgtac
gcttcatcatgtgtaacagatgaaagttacttcttggagaggatggaggaaaaccactac
aacacgtatcagtctcaaaagcacggggaaaactggtacgtcgggataaaaaagaacgga
aaaatgaaacgcggtccaagaacacacattggacaaaaggcgatcttctttctccctcga
caggtggaccagacaaaggactga

DBGET integrated database retrieval system