KEGG   Cyprinus carpio (common carp): 109110695Help
Entry
109110695         CDS       T05134                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00052  Galactose metabolism
ccar00500  Starch and sucrose metabolism
ccar01100  Metabolic pathways
ccar04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109110695
   00500 Starch and sucrose metabolism
    109110695
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109110695
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccar04147]
    109110695
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109110695
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109110695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NtCtMGAM_N Glyco_hydro_31 Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 109110695
NCBI-ProteinID: XP_018979227
LinkDB All DBs
Position
36
AA seq 408 aa AA seqDB search
MARICCGPLHTFALLTSVFLILVHKDKNVSFAFSPSAEWQHSTNISYRSVQFRENLSSNV
TVSADPRTHTRYVRDQCGIAVESRINCGCDRSLSRADCEARGCCYVPLPQSGLGGPPWCF
YPVRYPGYKMGPLLPTEKGQRATLARSAPSYLPRDIPTLQLDLMPETLGRLHLTLKDPAS
PRYEVPFVTSQSRGHKDIQNPLYDVDFQPDPFGFIVRRKSNGRVLLNTTIGPLLFADQYV
QLSTSMASSVISGLGEHYTPITLDLNWTSVSLWNRDMAPHRSANLYGSHPFFLVQEGDGQ
AHGVFLLNSNAMEVFLQPAPALTWVTVGGILDFYIFLGPSPQSVVQQYHEVIGYPMMPPY
WSLGFHLCRWGYTSTNITRTVVQLMRQAKIPLVRSPVAQYIPVFLNWG
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggccaggatctgctgtgggcccctgcacacctttgcactactgacttctgtatttctt
attctggtgcacaaggacaagaacgtttcatttgccttttctccatcagcagaatggcag
catagtacaaacatctcatacaggagcgttcagttccgagagaacttaagcagtaatgtt
actgtatctgctgatcccaggactcacactagatatgtcagagatcagtgtggtatagcg
gtggagagccgtatcaactgtggctgtgatagatctttgagccgggctgattgtgaggca
agaggatgctgctatgtgcctctgcctcagtctggattaggaggaccaccgtggtgtttc
tacccagtccgttacccaggctacaagatggggcccctgttgcccacagagaagggccaa
agagccaccctggcccgttctgcaccctcatacctgccccgggacatccccacactgcag
ctagatctgatgcctgagactttgggtcgtcttcacctcactctgaaagatccagcatct
ccacgatatgaggttccctttgtgacgtcccaatccaggggccacaaggacatacaaaac
cccctctatgatgtcgacttccaaccagatccgtttggattcatcgtacggcgaaaatcc
aatggccgggtccttctgaatactacaataggcccgctcctgtttgcagatcagtatgta
cagctctccaccagcatggcttcctctgtgatttctggcctgggtgaacattacaccccc
atcacgctggacctcaactggacctctgtttcattatggaacagagacatggcgccacat
agaagcgccaacctgtacggctcccaccctttctttttggtccaagaaggtgatggacag
gcacatggagtctttcttctcaacagcaatgcgatggaagtgtttctgcagcccgctcca
gcattaacttgggtgactgtcggaggaatactggacttctacatcttcttaggcccaagt
cctcagagtgtggttcagcagtaccatgaggttataggttatcccatgatgccaccctac
tggtcgctgggcttccacctctgtcgctggggttatacgtccaccaacataacaagaaca
gtggtacagctcatgcgccaggccaagatccctctagtacgttcccctgttgcccagtat
ataccagtgtttctcaactgggggtag

DBGET integrated database retrieval system