KEGG   Cyprinus carpio (common carp): 109111390
Entry
109111390         CDS       T05134                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta-like isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04141  Protein processing in endoplasmic reticulum
ccar04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109111390
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109111390
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109111390
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109111390
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf MCU
Other DBs
NCBI-GeneID: 109111390
NCBI-ProteinID: XP_018979866
LinkDB
Position
38
AA seq 523 aa
MMTSMGLFCVCAVLSSAATLKASSILSSKPLIQPKPVCVAALPLAQSSSPAKALILQSLP
VPVPPIDQNTTPVVLSQSVCLGSAPAIVKMEPLSPSMPHCTSPSAPPPSKPIIPASTLPG
NSCSDIDMKVLKRQQRMIKNRESACQSRKKKKEYLQNLEAQLREAQQENERLRRENQALR
LRLAGKEATESGSNKRALCVMALFLFITFTFGPVSLKDRTLEAGIEKAAIPLTGRRLLEF
ERSQELSRKRASERTTEQKKDREDEERWRKGELDKKAAVSYQFRNQSDVFSDVKDLLLQD
IDRYFSSSDCRQFNRSESLRLADELRGWVHRHQNNRKSDRKAKVVKKTKIAQQKAQHRKT
NFSRYLPIQAHRSIESQLQVLPGPEISYSDFLDAIDRREDTFYVVSFRRDHLLLPAISHN
KTTRPKMSLVMPAMAINDSVYNSSQGGYEMMMQVDCEVMDTRIIPIKSSVVPPSLRDPPP
TPPPHHHHGNHTSLRSRQQHLHGSGASSRRRAAGYLISQSGSG
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgatgaccagtatgggcctgttctgtgtgtgtgcagtcctctcctcagcagcgacgctg
aaggccagcagcattctgagcagtaagcccctgatccagcccaaacccgtgtgtgtggcc
gcgctgccgctggctcagagcagcagtccggccaaagctctcatcctgcagagccttccc
gtacccgtcccacccatcgaccagaacaccacgcccgtggttctgtctcagtccgtgtgt
ctgggttctgctcctgctattgttaaaatggagcctttgtctcccagcatgcctcactgc
accagcccctcagccccgcccccgagcaaacccatcatcccagcgtccaccctgcctgga
aacagctgcagtgacatcgacatgaaggttttgaagaggcagcagcgtatgataaagaac
cgggaatcggcctgtcagagccgcaagaagaagaaggagtacctgcagaacctggaggcg
cagctgcgggaggcgcagcaggagaacgagcgtctgcgcagagagaaccaagcgctgcgt
ctgcggctcgccgggaaagaggctacggagtctggcagcaacaaaagagctctgtgtgtg
atggctctgttcctcttcatcacctttaccttcggccccgtcagtctcaaagataggacg
ttggaagctgggatcgagaaagcggctatccctctgacaggaagacgcctgctggagttt
gagagatctcaggagctgagcaggaaacgagcaagcgagagaaccacggagcagaagaag
gacagagaggacgaagaacgctggaggaaaggagagctggacaagaaggctgcagtctcg
tatcagttcaggaatcagagtgatgtgttcagtgatgttaaagacctcctccttcaggac
atagacagatatttctcgtcctctgactgcagacaatttaaccgctcagagtccctcagg
ttggcggatgagctgcgtggatgggtccatcgtcatcagaataaccggaagtctgataga
aaggcgaaggttgtgaagaaaactaaaatagctcagcagaaagctcagcacagaaaaaca
aacttttccaggtaccttccaattcaggctcatcgttctatcgaaagtcagctgcaggtc
ctgcccgggccagagatcagctacagcgactttctggacgctattgatcgacgtgaggac
actttctacgtcgtatcattcagacgggatcacctgctgttacctgctatcagccacaat
aaaacaactcgacccaaaatgtctctggtcatgcctgccatggccatcaatgattcggtg
tataactcgtctcagggtggctatgaaatgatgatgcaggtggactgtgaggtgatggac
acccggatcatcccaatcaagtcctctgtagtcccgccctctctcagagacccgcccccc
actccaccccctcaccatcaccatggcaaccacacctccctccgcagccgacagcagcac
ttgcatggcagcggggcatcgtcgagacggagggccgcaggttacttaatcagccagagc
ggatccggttga

DBGET integrated database retrieval system