KEGG   Cyprinus carpio (common carp): 109111438
Entry
109111438         CDS       T05134                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109111438
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109111438
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccar04052]
    109111438
   00536 Glycosaminoglycan binding proteins [BR:ccar00536]
    109111438
Cytokines and growth factors [BR:ccar04052]
 Growth factors
  Growth factors (RTK binding)
   109111438
Glycosaminoglycan binding proteins [BR:ccar00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109111438
SSDB
Motif
Pfam: FGF Fascin CagA_N DUF799
Other DBs
NCBI-GeneID: 109111438
NCBI-ProteinID: XP_018979923
LinkDB
Position
4
AA seq 158 aa
MTERDITAFTLLPTTTEQKEPKHNSLQKLYCRNGGYHLRIQPNGTVDASRQENDVYTLLK
VKAVKAGLVAIRGHETGLYLAMDKYGKLYGTVMLNDECYFIEKIEENHYNTYRSQRYQEN
GDWYVGIKKNGWAKNGSKTHRGQNAIYFLPIPVDGSIQ
NT seq 477 nt   +upstreamnt  +downstreamnt
atgaccgagcgggatatcaccgctttcacactcctaccgacgaccaccgagcagaaagaa
cccaaacataactctctgcaaaaactttactgcaggaatggaggataccatctccggatc
caacctaacgggactgtggacgcgagtcgacaagagaacgacgtctacactcttttaaag
gtaaaagcagtgaaagcaggattagtggccattcggggtcatgagactggactatacctg
gcaatggacaaatatggaaaactttatggcactgtcatgttgaacgatgagtgttacttc
attgagaagatcgaggagaaccactacaacacataccgctcacagaggtatcaggagaac
ggggactggtacgtggggatcaaaaagaatggatgggcaaaaaacggctccaaaacacac
aggggccaaaatgcaatctacttcctgccaattccggtggatggcagcatacagtaa

DBGET integrated database retrieval system