KEGG   Cyprinus carpio (common carp): 109112680
Entry
109112680         CDS       T05134                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109112680
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109112680
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ccar03310]
    109112680
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    109112680
Nuclear receptors [BR:ccar03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   109112680
SSDB
Motif
Pfam: GCR
Other DBs
NCBI-GeneID: 109112680
NCBI-ProteinID: XP_018981131
LinkDB
Position
39
AA seq 424 aa
MDRGLKRSSNNAENVTFVDCIERGLFSDIGVNASALNTSKDFSNGQRGGDAQGNLSMADP
SLMGCNIQEPDVKAFKSFRMQHQQKVKEPLNIGENFSLLDESIADLNRGSGIQAPDAFTM
KMEFSPMEKDRVDFQPYGYPNKEMDGNERVTGDNTIDILNDLDLPDSLSDMNEFYVANEA
AFLSSLAVDDALLGESHLLKDTRPVVTGNSAACANVNGTGKRQQMVEASVNMPDIKTEKD
PDFIQLCTPGVIKQENERRSYCQMSGMGGPHGGPTALGDMGGQGYHYGANTASAVSLPDQ
KPLFGLFPPLPALSDGWARGNGYGDPSGMQRANETVLPSTYPYSRWELNMAACGMLANLR
DSSGYTTRCLGFVIPKADHQRGKPAQMKLYRKSEIAATVVDDQWLHGTLPPMIISCPEHL
LPAN
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggatcgtggactaaaacgcagcagtaacaatgctgagaatgtaacttttgtggattgt
attgagagaggccttttttctgatattggtgtcaatgcgtccgctttaaatacatcaaaa
gatttctcaaatggacagagaggtggtgacgctcaaggaaacctctctatggcagatccg
tccttaatgggatgtaacatacaagaaccagatgttaaggcatttaaatctttcagaatg
cagcaccagcaaaaggtaaaagagcccctcaacattggggagaacttttcgctcttagac
gagagcattgcggacttaaatcgtggttctggcatccaggcccctgatgcttttacaatg
aaaatggagttttcccctatggagaaagatagggtggactttcaaccctacggctatcct
aataaggaaatggatggtaatgagagagtgactggagacaacaccattgacatcctaaac
gatctggacttacctgactccctatctgacatgaatgagttctacgttgctaatgaggct
gcctttctgtcctcattggcagtggatgatgccttgctgggagagagccacttgctaaaa
gataccaggcctgttgtcactggcaacagtgcagcctgtgcaaatgtgaacggcacgggg
aaacggcagcagatggtggaagccagtgtcaacatgccggacataaagacagagaaagac
ccagactttatccagctgtgtacgccgggtgtcatcaaacaggagaatgagaggcggagc
tactgtcagatgtcagggatgggtgggcctcacggtgggcccaccgctttgggagatatg
ggcggacagggataccactacggagccaacactgcctcagctgtgagtttaccagatcag
aaacctctttttggcctgtttcctcccctgcctgccttaagtgatggctgggctcgagga
aatggatatggagatccgtctgggatgcagcgagccaatgagacagtacttccgtccaca
tatccgtacagcagatgggagctaaatatggcagcgtgtggcatgttggctaacctgcga
gacagttctggttacacgacaaggtgtctgggatttgtaataccaaaagcagatcatcaa
agaggtaaaccagcacaaatgaagctgtatcggaagagtgaaatcgctgcaacagttgtt
gatgaccagtggcttcatggcactctgccaccaatgattattagctgtcctgagcatctc
ctgccagctaattag

DBGET integrated database retrieval system