KEGG   Cyprinus carpio (common carp): 109112741
Entry
109112741         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: platelet-derived growth factor receptor alpha-like
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04020  Calcium signaling pathway
ccar04144  Endocytosis
ccar04510  Focal adhesion
ccar04540  Gap junction
ccar04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109112741
   04020 Calcium signaling pathway
    109112741
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109112741
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109112741
   04540 Gap junction
    109112741
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109112741
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109112741
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ccar04090]
    109112741
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109112741
Protein kinases [BR:ccar01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   109112741
CD molecules [BR:ccar04090]
 Proteins
  109112741
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set Herpes_gE Kinase-like SKG6
Other DBs
NCBI-GeneID: 109112741
NCBI-ProteinID: XP_018981187
LinkDB
Position
39
AA seq 1460 aa
MGFLETHLVFGIVLLGVLSDVSKPWPVINSDKKEFILTPHSEFTITCSGERRVTWFEPLA
ANTEVQSGFNHSTLVITDAVASNTGYYTCLYEDQPEKDTDIYVFVLDPEVPFVSEPAVEI
DEAVGTIIPCRATNPHSQVILRNLQSGDEVSVPYNPKLGFFGVLSPGHYVCEMSVNGKAV
HSIVYNVTNDKDYKEKSFSIQLRASMEDVKEGDAVNLTCETPPGEAFRQQWLHPQKQARG
AVPMKLTFPDKVQYILNIPEASVADTGRYECAVTNQLTGQTESLILGITVHERSFVEVIS
NGIGPVEVVSLLEEKEFTIYIDADPEPKVRWFKDGLQLDDSYISTKTTHLTGLRYENILV
LRHPIEEDSGVYEIVASTGSRTSSFSFKLLVEAMYPELPQSVLAPVMWPQRDSMEVSLHS
TFRLTCRGQTELSWNSPVYLHDQIDTAVYLHDQIDTAKKGLFISTVTVGNATAAHTGEYI
CYYDSSNNTEETSIYIYVPDPETPFVPSMSPFENHVLTSHDEMEIPCRVTDPSTTVSLIH
IETNQVLSSVYDSKRGFIGFFGAGTYVCRALINGQKHDSIQYIVHGWTGGSDLRVELRAX
KEALLVGETITVDCVARGSEMLEDHWKYPGETVKTVKENKRDLEIHYTLTVTNASPKDSG
VYACSITDIMSNESQTKQLTITVYESEFVRINPVTGPVETARLDEVREFXVDIQSFPAPK
VIWLKDGSVLGDVAAEITTNLLKIDEISYEGVLTLIRAKAEDSGNYTIRAETGSQTTSNS
FYLQVKVPPVIVDLMDIHHGSAAGQEVVCAASGSPTPDVDWYICKNIKHCANDSSQWMPL
PINSTDITVELQMNEDNNVESQVIFHHLESTIAVRCLARNDMGAVSREVKLVSNGLHSEL
TVAAAVLVLLVIVIISLIVLLIIWKQKPRYEIRWRVIESVSPDGHEYIYVDPMQLPYDSR
WEFPRDSLVLGRVLGSGAFGKVVEGTAYRLSRSQPVMKVAVKMLKPTARSSEKQALMSEL
KIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDGFLSRHTEKGKKGL
DIFGINPADESSRSYVILSFEGKGDYMDMKQADTMQYVPMLEMNETSKYSPLQRSDYDHP
PSQRQFNESEVENLLSDDTNEGLTTVDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLS
QGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILIWE
IFSLGGTPYPGMVVDSSFYNKIKSGYRMAKPEHASSEVYELMMKCWNSEPEKRPSFHSLS
DTVASLLPSGYKRCYERVNHDFLKSDHPAVTRVQCTDNEDVYMGVLYKNQGKLKDRESGF
DEQRHSSDSGYIIPLPDLDPLSNEEYSKRNRHSSQTSEESAIETGSSSSITKREGETLED
ITLLDEMCLDSGELVEYSFL
NT seq 4383 nt   +upstreamnt  +downstreamnt
atggggttcctggagacacatctcgtttttgggattgttttactaggggtattgtcagat
gtttcaaaaccttggccggttattaattcagataaaaaggaatttattctgacacctcat
tctgagttcaccatcacttgctccggagagaggagagtgacatggttcgagccattagcg
gccaacactgaagtgcagtctggatttaatcacagtactttggtgatcactgatgctgtg
gcctctaacacaggatactacacctgtttgtatgaggatcaacctgaaaaagacactgat
atctatgtttttgttctagatcctgaggttccatttgtgtctgaacctgctgttgagata
gatgaggcagtgggcacaattatcccctgccgtgctacaaacccacattctcaagtgatt
cttagaaacctgcagagtggggatgaggtttctgtgccttacaaccccaaactcgggttt
tttggtgtattatcaccgggtcactatgtttgcgagatgagcgtgaatggcaaagcagtg
cacagcatcgtttataatgtgacaaatgataaggattataaagagaagagcttcagcata
cagctgagagccagtatggaggacgtgaaagagggggatgctgtcaatcttacctgtgag
acccctcctggggaggctttccgccagcagtggctgcatccccaaaaacaggccagaggg
gctgttccaatgaagttaactttcccagacaaggttcagtacatcctcaacatcccagaa
gcctctgtggcagatactggacgctatgagtgtgctgtaaccaaccaattaactggacaa
accgagtctctcatcctgggaatcacagtccacgagagatcttttgtagaagtaatatct
aatggcattgggccagtggaggttgtatcgcttctggaggaaaaagagtttactatttac
attgatgctgaccctgagccaaaggtcaggtggtttaaagatggccttcagctggatgac
agctacatctccaccaagactactcatctgacaggcctcaggtatgaaaatattctggtt
ctccgccaccccatagaggaggacagtggcgtctatgagattgttgcgtccactggttcc
agaacttcaagcttttcattcaaactgctggttgaagccatgtacccagagctgccacag
tcagtgctggctccagtgatgtggccccagagggacagcatggaggtgtctctccactcc
actttcagactcacatgtcgaggtcagaccgagctctcctggaacagccctgtttatctc
cacgatcagatcgacactgcagtttatctccacgatcagatcgacactgcaaagaaagga
ctcttcatctccaccgtgactgttggcaatgcaacggccgcccatacaggagagtacatc
tgctactatgactccagcaacaacactgaggagacttccatctatatttatgtgccagat
ccagaaacgccgtttgtgccttccatgtccccttttgaaaaccatgtgctaacgagtcat
gatgaaatggagattccctgccgtgtgacagacccaagcaccaccgtctctctgattcac
attgagaccaatcaggttctgtctagtgtctatgacagcaagagaggattcattggtttc
tttggtgctgggacgtatgtctgcagggccctcattaatggacagaaacatgacagcata
cagtacatcgtgcacggctggacaggagggtctgatttgcgagtcgagctgcgagcanga
aaagaagctctgctggtgggtgagaccatcactgttgactgtgtggccagaggcagtgag
atgctggaggaccactggaaataccctggggaaactgtaaagaccgtaaaggagaataag
cgagatcttgagatccattatactctgacagtgactaatgcctcaccgaaagacagcggt
gtctacgcctgctccattactgatattatgagcaatgagagccaaaccaaacagctcact
attacagtctatgaaagtgagtttgtgcgcataaatcccgtaactggtccagtggagact
gctaggctggacgaggtgcgagagttcnaggtggacatacagtctttccccgccccaaaa
gtcatatggttaaaggacggctcggtcctaggagatgttgctgcagagatcaccaccaac
ctcctaaaaattgacgagataagttacgagggtgtgttgaccctgatcagagctaaagca
gaggacagtgggaactataccatcagggcagaaacaggcagccagactaccagcaacagt
ttctaccttcaggttaaagttccccctgtgattgtggacttgatggatatccaccatggc
tctgctgcaggtcaggaagtagtgtgtgctgcaagcggctcccccacccctgacgtggac
tggtatatctgcaaaaacattaaacactgtgccaacgattcctcccagtggatgccactt
ccgatcaactctacggacatcactgtggaattgcaaatgaatgaggacaacaacgttgag
agtcaagtcattttccaccatcttgagagcacaattgctgtgcgctgtctggccaggaat
gacatgggtgctgtttcacgagaggttaaactagtgtcaaatggtctgcactcggagctc
actgtggctgctgctgttctggtgctgctggtcattgtcatcatctcacttattgtgctg
ctcattatctggaaacagaaaccacgttatgagatcagatggcgtgtgattgaatcggtc
agcccggacggtcacgagtacatctatgtcgatcccatgcagcttccatatgactcccgc
tgggagttccctcgggattcacttgtactgggtcgtgtcctgggctcaggagcatttggg
aaagtggtggaaggcactgcttacagactcagtcgttctcaacctgtgatgaaagtggct
gtgaaaatgcttaaaccaacagcacgctccagtgagaagcaggctttgatgtcagagctg
aaaattatgacccacctgggcccacacctaaacatcgtcaaccttctgggagcatgcacc
aaatcaggaccaatctacattatcacagagtattgtttctatggagacctggtgaattac
ctgcataagaacagagatgggtttctcagccgccacacagaaaagggcaagaaaggtcta
gacatctttggcatcaacccagccgatgagagtagcaggagctacgtcatcctgtctttt
gaggggaaaggtgattatatggacatgaagcaagcagacaccatgcaatacgtccccatg
ctggaaatgaatgaaacctcaaaatactcccccctccagagatcagactacgaccatcct
ccatctcagagacagttcaacgagagtgaagttgagaaccttctctcagatgacaccaat
gaaggcctgacaacagtggacctcctcagtttcacctatcaagtagctcgagggatggag
ttcttagcctctaagaattgtgtacacagagacttggctgcacgtaatgtcctgctgtct
caaggcaagatagtgaagatctgtgactttggactggccagagacatcatgcacgataac
aactatgtctccaaaggaagtactttccttccagttaaatggatggcccctgagagtatt
tttgataacttatacactacactcagtgacgtctggtcttatggcatcttaatatgggag
atcttctcgcttggagggactccttatccaggtatggttgtggattctagcttctacaac
aagatcaagagtggataccgaatggcaaaacccgagcacgcttccagcgaagtctatgag
cttatgatgaaatgttggaacagtgaaccagagaagagaccatctttccacagcctgagt
gatacggtggcctctctgctgccctcaggatataagagatgctacgaacgcgtgaatcat
gacttcctgaagagcgatcaccctgctgtgactcgggtgcagtgcactgacaatgaggat
gtgtacatgggtgtgctctacaagaaccagggcaaactaaaggaccgcgagagcggcttt
gatgaacagagacacagctctgacagcggttacatcattcctctgccagacctcgaccca
ctgtcaaatgaagaatacagcaaaaggaaccgccacagctctcagacgtcggaggaaagc
gcaatagagacaggctctagcagctccattactaagcgtgagggagagaccctggaggac
atcaccttgctggacgagatgtgcttggactcaggagaattggtggagtatagtttcctg
tga

DBGET integrated database retrieval system