KEGG   Cynara cardunculus var. scolymus (artichoke): 112500213Help
Entry
112500213         CDS       T05604                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00620  Pyruvate metabolism
ccav00710  Carbon fixation in photosynthetic organisms
ccav01100  Metabolic pathways
ccav01200  Carbon metabolism
Module
ccav_M00168  CAM (Crassulacean acid metabolism), dark
ccav_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
ccav_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
ccav_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    112500213
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    112500213
Enzymes [BR:ccav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     112500213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 PMI_typeI WbqC
Motif
Other DBs
NCBI-GeneID: 112500213
NCBI-ProteinID: XP_024959350
LinkDB All DBs
Position
LG 17
AA seq 966 aa AA seqDB search
MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKETVQEC
YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK
LKKGDFVDEANATTESDIEETLKKLVHKLKKSPEEVFDALKNQTVDLVFTAHPTQSVRRS
LLQKHGRIRDCLAQLYAKDITPDDKQELDEALHREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANMYFSQIEDLMFEMSMWRCSDELRVRAEELYRSSSKRDVKHYIEFWKQV
PPTEPYRVILGDVRDKLYNTRERSRHLLAHDVSDIPEELVYTDVEQFLEPLELCYRSLCA
CGDRVIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITQHLEIGSYREWSEEK
RQEWLLAELSGKRPLFGPDLPKTEEIADVLDTFHVLAELPADCFGAYIISMATSPSDVLA
VELLQRECHVKQPLRVVPLFEKLADLDAAPAAVARLFSIEWYRNRIDGKQEVMVGYSDSG
KDAGRLSAAWQLYKAQEELIXVAKKXGVKLTMFHGRGGTVGRGGGPTHLAILSQPPETIH
GSLRVTVQGEVIEQSFGEEHLCFRTLQRFCAATLEHGMNPPISPRPEWRALMDEIAVYAT
EQYRSIVFKEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGFGAAFKHAIEKDIKNLHMLQEMYKTWPFFRVTIDLVEMVFAKGDPGIAALND
KLLVSEDLWSFGELLRANYEETKNLLLRIAGHKDLLEGDPYLRQRLRLRDSYITTLNVCQ
AYTLKRIRDPNYHVTLRPHISKEYAEPSKPADELIKLNPKSEYAPGLEDTLILTMKGIAA
GMQNTG
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggctaatcggaatttggagaaattggcatcgatcgatgcgcaattgaggcttttagtt
cctggaaaagtttcagaggatgataagctgattgagtatgatgctttgcttttggacaag
tttcttgatattcttcaggatttacatggagaggatctcaaagaaacggttcaagagtgc
tacgagctttctgctgagtatgaaggaaagcatgaccctaagaagctggaggagcttgga
aatgtgttaacaagtttagatccaggggattccattgttattgcaaaagccttttctcac
atgcttaacttggccaatctggctgaagaggttcagattgcttatcgccggaggattaaa
ctgaagaagggtgactttgttgatgaggctaatgcaacaactgaatctgatattgaagaa
actcttaagaaacttgtacataagcttaagaaatcccctgaagaagtgtttgatgcactc
aagaatcaaactgttgatctagttttcactgctcatccaactcaatctgtccgcagatct
ttgcttcagaagcatggaaggattcgggactgtcttgcgcagttatatgccaaagatatc
acccctgatgataagcaggaacttgatgaggctttgcacagagaaattcaagctgctttc
cgcactgatgaaatccggaggactcctccaaccccacaagacgaaatgagagctgggatg
agttacttccatgaaacaatatggaagggcgttcctaaattcttacgtcgtgttgacact
gctctcaagaacattgggatcaatgaacgtgttccgtataatgcccctcttatacaattt
tcttcctggatgggcggtgaccgtgatggtaatccaagggtaacccctgaggtcacaagg
gatgtttgcttacttgcgagaatgatggctgcaaacatgtacttctcccagattgaggat
cttatgtttgagatgtccatgtggcgttgtagtgacgaactccgtgttcgagcagaagaa
ctctatcgatcatcatcaaagagagatgtcaaacactacattgagttctggaaacaggtt
cctcctaccgaaccataccgtgttattcttggtgatgttagggacaagttgtataatacg
cgtgaaagatcacgccatctgttagcacatgacgtatctgacattccagaggagttggtt
tataccgatgttgaacagttcttggaacctctagagttatgctaccgatcgctatgtgct
tgtggtgatcgagtgattgctgatggcagccttcttgatttcttgcggcaagtctccacc
tttggactctcgcttgtgaggctcgatatccgacaagaatcagaccgccacacggatgtc
cttgatgccatcactcaacatttggaaatcgggtcttaccgtgaatggtctgaagagaag
cgccaagaatggcttctagctgagctaagcggaaaacgcccgctattcggccccgatctc
ccaaaaaccgaggaaatcgctgatgttttggatacattccatgtgttggcggaacttcca
gcagattgttttggtgcttacattatctccatggctacatccccttctgatgtgcttgct
gttgagttgcttcaacgggaatgccatgtaaagcaaccgttgagggtggttccacttttt
gagaaacttgcagatctcgatgcggctcctgctgccgtggcccgtcttttctcgatcgag
tggtacagaaaccggattgatggtaaacaagaagttatggttgggtattcggattcagga
aaggatgctggaaggctttctgctgcgtggcaactgtacaaggctcaagaagagcttata
aasgttgckaaaaagtwyggagttaagctcaccatgttccatggacgtggtgggaccgtt
gggcgaggaggcggacccactcatcttgctattctctcccaaccacccgagactattcat
gggtcactccgagtcaccgttcagggtgaggttatcgagcaatcttttggtgaagaacat
ttgtgtttcagaactcttcagaggttttgtgcagctacccttgagcatgggatgaacccc
ccgatctcaccacgacccgaatggcgtgcacttatggatgagatcgcagtttatgcaacc
gagcaataccgttcgattgtgttcaaggaaccacgttttgtcgagtatttccgtctcgcc
acgccagaactagaatacgggcggatgaacatcggaagtcgtccatcgaaacgaaagccg
agcggaggcatagaatctctccgagccattccgtggatctttgcatggactcaaaccagg
ttccatctccctgtttggctcgggttcggggctgcattcaaacatgccatcgagaaagac
atcaagaatcttcacatgctacaagaaatgtacaaaacatggcctttctttagggtcacc
atcgatttagttgaaatggtgttcgctaagggtgatcctggcattgctgctttgaacgac
aagctcctcgtgtctgaagacctatggtcgtttggagagttgttgagagccaactatgaa
gaaaccaagaatcttctcctccggattgctggacataaggatcttctcgagggtgatccg
tacttgagacaaagactccgtctacgtgattcctacatcacgaccctgaacgtatgccaa
gcgtacacactgaaacggatccgtgatccaaactatcacgtgacattgaggcctcatatc
tcaaaagagtatgccgagccaagcaaaccagcggacgagcttatcaaactaaacccgaag
agtgagtacgccccaggattggaggataccctcatcttgaccatgaagggtatagctgct
ggaatgcaaaataccggttaa

DBGET integrated database retrieval system