KEGG   Cynara cardunculus var. scolymus (artichoke): 112500270Help
Entry
112500270         CDS       T05604                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00562  Inositol phosphate metabolism
ccav01100  Metabolic pathways
ccav04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112500270
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112500270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccav01009]
    112500270
Enzymes [BR:ccav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112500270
    3.1.3.48  protein-tyrosine-phosphatase
     112500270
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     112500270
Protein phosphatases and associated proteins [BR:ccav01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    112500270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 CDKN3
Motif
Other DBs
NCBI-GeneID: 112500270
NCBI-ProteinID: XP_024959466
LinkDB All DBs
Position
LG 17
AA seq 623 aa AA seqDB search
MNCDITTVIVLYNFWFIVFPCFSYGSRLRNKWTYTQGVRLQKATVAHYICSWLLLFFVVL
KRSETQNGFGNWLSASGITTWAKSLKLPQPLGGTQDESSSENTGKSSFARLTSGLGLRLS
PKAPQQDDSPDGTPTTPQAGIFGTITKGFVDTSKNAVKAVQVKARHVVSQNKRRYQEGGF
DLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIRFFETYHKDKYKVYNLCSE
RLYDASLFEGKVASFPFDDHNCPPIRLIISFCQSAYSWLKEDIENVVVVHCKAGMARTGL
MISSLLLYLKFFPTAEESISYYNQKRCVDGKGLVLPSQIRYVKYFERVMTYFNGEDQPGR
RCMLRGFRLHRCPYWIRPSITVSDHNGVLFSTKKHPRTKDLSPEDFWFSAPRKGIMVFAL
PGEPGLTELSGDFKIHFHDRQGDFYCWLNTTMIENRKVLTTNDLDGFDKRKLPSPGFQVE
VVVVDYDNAAQAKPETESTAKPAEGTSANPPPTTPSEATSTNLPKDSRNSEKDDEVFSDT
ESEAKTDTASETNSVSGKMVSLSNDTKNLSIGNSGASQTTPASAPKADEAASRNPIGEVS
DFKAMAADTSVFTFGDDEDYESD
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtgatatcacaactgttattgttctgtacaacttttggttcattgtttttccg
tgcttctcttatggttcaaggctcaggaacaagtggacctacacacaaggggtgcgattg
cagaaagctacagtggcacattacatctgtagttggttgcttctgtttttcgttgtgtta
aagagatctgagacgcaaaatggatttggaaactggctgtctgcttctggcataaccaca
tgggctaaaagcctgaagcttccgcaacctctgggaggcacacaggatgaatcttcatct
gaaaatactgggaagtcatcgtttgctcgtttgactagtggacttgggttgcggttgtct
ccaaaagctcctcaacaagatgatagccctgatggaactccaacaacgccacaagctggc
atttttgggacaattactaaaggttttgtagacacgtctaaaaatgcggtgaaggctgtc
caggtcaaggctcgtcatgttgtatcacaaaacaaaagaagatatcaggaagggggattt
gatttagatatgacatacatcactgagaatatcattgctatgggattccctgctggtgat
atgagctccggtttcttcggatatgtcgagggattttatcgaaaccacatggaggaagtt
ataaggttctttgaaacctatcacaaggataagtacaaggtatacaacctgtgctctgag
aggctatatgacgcatcactgtttgaagggaaggttgctagtttcccatttgacgaccat
aattgtcctcccattcggctcataatatcattttgccagagtgcatactcatggctgaag
gaagacattgaaaatgttgtggttgtgcactgtaaggctggaatggcaaggacaggctta
atgatttcaagtcttcttttatatctgaagtttttccccacagctgaggagtctatatca
tactacaaccaaaaaagatgtgttgatggaaaggggcttgttctcccaagtcaaataaga
tatgtcaaatattttgaaagagttatgacatacttcaatggagaagatcagcctgggcgc
aggtgtatgcttagaggatttcgccttcataggtgcccatattggatcaggccctctatt
accgtctctgatcataatggtgttctcttttcaaccaagaagcatcccagaaccaaggat
ctatcgcctgaagatttttggttttctgcaccaagaaagggtataatggtctttgctctg
cctggggagcctggcctgaccgagttatctggagatttcaaaatccattttcatgaccgg
caaggcgatttctactgctggctgaacacaacaatgatcgagaataggaaggttctaacc
acaaatgatcttgatgggtttgacaagaggaaattgccttcccctgggtttcaagtggag
gttgtggttgtggactatgacaatgctgctcaagcaaaacccgaaactgaaagtactgcc
aaaccagctgaaggtacaagcgcaaatcctccgccaaccaccccctctgaagccacctcc
acaaacttaccaaaagactccagaaatagcgaaaaagacgacgaggtgttctccgacacc
gaatccgaagcaaaaaccgacactgcttctgaaaccaattctgtctctgggaaaatggta
agcttgtcaaatgacaccaagaatctgtctataggaaactcaggcgcatcacagacaact
cccgccagtgcgcccaaagccgatgaagctgcatcccgaaacccgatcggagaggtaagt
gatttcaaggcaatggcggctgatacatccgtttttacatttggagacgatgaagactat
gaaagtgattga

DBGET integrated database retrieval system