KEGG   Cynara cardunculus var. scolymus (artichoke): 112506576Help
Entry
112506576         CDS       T05604                                 

Definition
(RefSeq) SWI/SNF complex subunit SWI3D isoform X1
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ccav03021]
    112506576
   03036 Chromosome and associated proteins [BR:ccav03036]
    112506576
Transcription machinery [BR:ccav03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     112506576
Chromosome and associated proteins [BR:ccav03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    112506576
   PBAF complex
    112506576
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM-assoc_1 SWIRM Myb_DNA-binding ZZ Myb_DNA-bind_6 C1_2
Motif
Other DBs
NCBI-GeneID: 112506576
NCBI-ProteinID: XP_024966488
LinkDB All DBs
Position
LG 2
AA seq 978 aa AA seqDB search
MEEKHNSPATATEAATPSSAELPSSRRRGGGLKRKASILSNSNTSTPPPSLSSKRQAREK
PSPVLFPPIHNGPCTRARQQPNYADSTSFWDAVIVNGEGEGSMLGTPVAAKVEEELNARK
EAWEALEAKMEAEYDHLKARDANSQVVPISCGWFSWTKVHQLEEKAMPSFFNGEVENRTP
ELYMEIRNSIMKRFHANPNTEIEAKDLSEISIGELDAKEEVMEFLEYWGLINYHPFPEAD
ITSSMGDAEEAAKVNSLIQNLYEFEVEQLCPPAAPRTSLATLAVPSRLPESMITDESVQP
EGPSVEYHCNSCAADCSRKRYHCQKQADFDLCTDCFNDGKFDSDMSPSDFIIMEPADAAG
ASSGKWTDQETLLLLEALELFSENWNEIAEHVATKTKAQCILHFVQMPIEDTFRDCDDED
DASNKEKAEKKDASPDENDEKKEVDASPEENVDKVEVDVNLKEKTDAVAIKNDTPLGDSP
DMKETDDPKALLNTDALPPDDAPSNNDEPDPSPMDISESADPDKLKDNQENGVNIAVKAL
REAFDAVGSRPSHDGKLSFADAGNPVMAMAAFLSRLVDPNIVTASARTSLKSVSSGGTGL
QLSARHSFVIEHPTDEKKPDNTERDVQEKVEQEGMKDKTDSSRKQEEEKSSLILSDSSVN
DDNDKEGKKESSVSHGEKKNPIPAEVVLPKKGKNVGRKGISASSKKDKDPITEKAIIAAE
TNEQTDQIENPSSSKKESEGSADGGPPLGVSRSTEAPKDEEMVSKSLPSETAEPHQSNTS
LAENTANSEEAGAKDCKNVNKHPLDTKDDPDMHKLTSAAVTAISAAAVKAKFLADQEEDQ
IRQLATSLIEKQLHKLETKLAFFTEMDGVVARVREQMERSKQRLYHERAQIIAARLGMSS
AASTRPMPHPLPNRGGMPFPNAVQRPPSPMSMTPQRPPLSRPMMAPTPFSNPIIPSTVAG
NSAQISNNPDKLSSVGMK
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaagcacaattcaccggcgaccgccaccgaagcggcaacaccatcgtcggcg
gagctaccatcttcacggagaagaggcggagggctgaagaggaaagcctcgattcttagc
aacagcaacacatcgactccgccaccgtcgttgtcttcgaagcgtcaagctcgtgagaaa
ccatcgccggtgctgttccctccgatccacaatggaccgtgcaccagagctcgtcaacaa
ccaaattacgctgactctacgtcgttttgggacgcggtgattgtgaatggcgaaggggaa
ggttcgatgttggggacgccggtggcggcgaaggtggaggaggaattgaatgctaggaaa
gaagcctgggaggcgttggaagcgaagatggaagctgaatatgaccacttaaaagcgcgt
gatgctaattcccaggttgtaccgatttcttgtggttggttctcatggacaaaagttcat
cagttggaggagaaagcaatgccttctttctttaatggagaagtggaaaatcggactcct
gaactttacatggagataagaaactccattatgaaaagatttcatgccaatcccaatact
gaaattgaggcaaaagatctttctgagatatcaattggagaactggatgctaaggaagag
gtgatggagtttttagagtattgggggttgattaattatcatccattccctgaggcagat
atcactagctcaatgggtgatgctgaagaagctgcaaaagtaaattcattgatacagaat
ctgtatgagtttgaggtggagcaattgtgcccaccagcagctcccaggactagtcttgca
acccttgctgttccatcccggttgccagagtccatgataactgatgaatcagtgcagccc
gagggaccatctgttgagtatcactgcaattcatgtgcagctgattgctctcgtaagcgt
taccactgccagaagcaggcagattttgacttatgtactgattgcttcaacgacggcaag
tttgattccgatatgtccccatctgatttcattattatggagcctgctgatgctgctggg
gcaagtagtgggaagtggacagaccaagagacactgctccttcttgaagccctggaacta
ttcagtgagaactggaatgagattgctgaacatgtggccacaaaaacaaaagctcagtgt
atattgcactttgttcaaatgccaattgaagatactttccgggactgtgatgatgaagat
gatgcaagtaacaaggaaaaagctgagaagaaagatgcaagtcccgatgaaaatgatgag
aaaaaagaagttgatgcaagtccagaggaaaatgtggacaaagtagaagttgatgtaaat
ttgaaggaaaaaacagatgcagttgcaatcaagaatgatacacctctcggtgattcccct
gatatgaaagaaactgatgatcctaaggccctcctcaatactgatgctttgcctccagat
gatgctccatccaataatgatgaacctgatccctctccgatggacatttcagaatcagcg
gatcctgataaactaaaagataatcaggagaatggtgtgaacattgcagtgaaagcactc
agagaagcatttgatgctgtgggttctcgtccttcccatgatgggaaactttcttttgct
gatgctggcaaccctgtcatggcaatggcagcattcttgagtcggttggtggatcccaat
attgtcactgcttcagcccgtacttctctgaaatctgtttctagtggtggcactggcttg
cagctctctgcaaggcattcctttgttattgaacatccaacagatgagaagaaaccagat
aacacagagagagatgtccaagaaaaggtggagcaagagggcatgaaagacaagacagat
tctagcaggaagcaggaagaagaaaagtctagcttaattcttagtgacagttcagtaaat
gatgataatgacaaggaaggtaagaaagaatcttctgtttctcatggagaaaagaaaaat
cctattccagcagaagtggtgcttcccaagaaaggcaagaatgttggtagaaagggcatt
tctgcttcttcaaagaaagacaaggatccaattaccgagaaggcaattattgctgcagaa
actaatgagcaaacagatcaaatcgagaatccttcaagttctaaaaaggagtctgaaggt
tctgctgatggtggtccaccgttaggggtctctcgttctacagaggctccaaaagatgag
gagatggtatctaaatcccttccgtcagagacagcagagcctcaccaatctaacacttca
ctggctgaaaacactgcaaactcagaggaggcaggagcaaaagactgtaagaatgtgaac
aaacacccactagacactaaagatgacccagacatgcataaattaacaagtgcagctgtc
actgccatctctgctgcagcagttaaggcaaaattcttggcagaccaggaagaggaccag
attagacagcttgccacatcgttaatagagaagcagctgcacaagttggagactaagttg
gctttctttaccgagatggatggtgttgtagcgagggttagggaacagatggaaaggtca
aagcaaagactttaccatgaacgtgcccaaataatcgctgccaggctgggcatgtcatct
gccgcttctaccagacctatgccgcatccattacccaacagaggtggaatgccgtttcca
aatgctgtacaaaggccaccaagtccaatgagcatgactcctcaaaggccaccactctca
agaccaatgatggcaccgacacccttttctaacccaattatacctagcacagttgcggga
aactcagctcagatttcaaacaacccggataaactctcatcggttgggatgaagtga

DBGET integrated database retrieval system