KEGG   Cynara cardunculus var. scolymus (artichoke): 112509698Help
Entry
112509698         CDS       T05604                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00010  Glycolysis / Gluconeogenesis
ccav00053  Ascorbate and aldarate metabolism
ccav00071  Fatty acid degradation
ccav00280  Valine, leucine and isoleucine degradation
ccav00310  Lysine degradation
ccav00330  Arginine and proline metabolism
ccav00340  Histidine metabolism
ccav00380  Tryptophan metabolism
ccav00410  beta-Alanine metabolism
ccav00561  Glycerolipid metabolism
ccav00620  Pyruvate metabolism
ccav00903  Limonene and pinene degradation
ccav01100  Metabolic pathways
ccav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112509698
   00053 Ascorbate and aldarate metabolism
    112509698
   00620 Pyruvate metabolism
    112509698
  09103 Lipid metabolism
   00071 Fatty acid degradation
    112509698
   00561 Glycerolipid metabolism
    112509698
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    112509698
   00310 Lysine degradation
    112509698
   00330 Arginine and proline metabolism
    112509698
   00340 Histidine metabolism
    112509698
   00380 Tryptophan metabolism
    112509698
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    112509698
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    112509698
Enzymes [BR:ccav01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     112509698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 112509698
NCBI-ProteinID: XP_024970563
LinkDB All DBs
Position
LG 3
AA seq 533 aa AA seqDB search
MAARRISGFISRSLSSSIASPGRTCNLRSEIQRFSTAAALQEPITPPVRINYSQLLIDGK
FVDAASGKTFPAFDPRTGEVIANVAEGDAEDINRAVSAARKAFDEGPWPKMTAYERSCVL
LRFADLVEKHNDELAALESWNNGKTYEQAAKSEVPMLARLFRYYAGWADKIHGLTVPADG
PYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKSAEQTPLTALYAAKLL
LEAGLPPGVLNVVSGFGPTAGAALASHMDVDKIAFTGSTETGKIVQELAAKSNLKAVTLE
LGGKSPFIVCEDADIDKAVELAHFALFFNQGQCCCAGSRTFVHERVHEEFLEKSKARALR
RTVGDPFQKGIEQGPQIDSEQFEKILRYIKSGVESNATLECGGDRFGSKGFYVQPTVFSN
VKDDMLIAKDEIFGPVQSILKFKEIDEVIKRANATRYGLAAGVFTQNLDTANRLSRALRA
GTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTALKNPAWL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcgaagaatctccggcttcatctcccgttctctttcgtcttcaatcgcttct
ccaggaagaacgtgtaacttgagaagtgaaatacaaagatttagcactgctgctgcactt
caggaaccaattactccacctgttcgtattaattacagtcagcttctaattgatgggaaa
tttgttgatgcagcatccgggaagacatttccagcctttgatccgcggacaggggaagtc
attgccaatgtagccgaaggtgacgcagaggatataaatcgtgcagtttctgctgctcgc
aaggcttttgatgaaggcccgtggcctaaaatgactgcttatgagcggtcgtgtgtcttg
ctgagatttgctgatttggtggagaaacacaacgatgagcttgcagcccttgagtcatgg
aacaatgggaagacttatgagcaggctgcgaaaagtgaagtaccaatgcttgcacgtcta
tttcgctattatgctggttgggcagataagatccatggtctaacggttccagccgatgga
ccttaccatgtgcaaactttgcatgaaccaattggcgttgccggtcagatcattccatgg
aactttcctcttcttatgtttgcatggaaagttgggcctgcccttgcttgcggcaacacc
atcgttctgaaatctgcagaacaaactccattgaccgctctttatgctgcaaaattgctc
ctcgaggctggtcttcctcctggtgttcttaatgtagtttcaggctttggtcctactgct
ggtgcagctcttgctagccatatggatgttgataagattgcttttacaggatcaacagaa
actggtaaaattgtgcaagaattggctgcaaaaagcaatcttaaggcagtgactttagag
cttggagggaaatcgccttttatcgtgtgcgaggatgctgacatagataaggctgttgaa
ctagcacactttgctctcttcttcaatcaaggccaatgttgttgcgctggttctcgtaca
tttgttcatgagcgggtacatgaagagttcttggagaaatcaaaagcccgtgctctaaga
cgcaccgttggtgatcctttccagaagggcattgaacaaggccctcagatcgactcggag
caatttgagaagattctacgatacataaaatctggggttgaaagcaatgctacccttgaa
tgcggaggtgacagattcggctccaaaggtttctacgtccaaccaactgttttctccaat
gttaaggatgacatgctgatagcaaaagatgagatctttggtcctgttcagtccatcctg
aaattcaaggagattgacgaggtgataaagagggctaacgcgacacgatatgggcttgca
gccggtgtgttcacgcaaaacctcgatacggctaaccgattgagccgggcattgagggct
gggacagtttgggtgaattgctttgatgtttttgatgctgcaattccttttggagggtat
aagatgagtggtattggaagagagaagggtatttacagccttcacaattacttacaggtg
aaggctgtcgttaccgctctcaaaaatccagcatggttgtaa

DBGET integrated database retrieval system