KEGG   Cynara cardunculus var. scolymus (artichoke): 112511833Help
Entry
112511833         CDS       T05604                                 

Definition
(RefSeq) serine/threonine-protein kinase ATM isoform X1
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    112511833
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccav01001]
    112511833
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ccav03032]
    112511833
   03400 DNA repair and recombination proteins [BR:ccav03400]
    112511833
Enzymes [BR:ccav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112511833
Protein kinases [BR:ccav01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   112511833
DNA replication proteins [BR:ccav03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     112511833
DNA repair and recombination proteins [BR:ccav03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    112511833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FATC TAN
Motif
Other DBs
NCBI-GeneID: 112511833
NCBI-ProteinID: XP_024973394
LinkDB All DBs
Position
LG 4
AA seq 3132 aa AA seqDB search
MVTSGDVQEIVLKLSSDKAKAREEGIKLLNTWLEGERLIEFCRYLGRNTSMLKPHDIPHA
ETWPFLVKLLTKAISLEVYSSKRRLPKLAFAKTLRIVVLRAEDGKSLHLLSVAKLLFNHI
WDILKDVPSFQSEYGIILRHLLEVKHLQFHLRKRVYSSLVLLYMGKVETSLSERNFGQSN
PKEEVFRCILTLHSLLDSPPGDFSNDLQEGITQGFVEIFSNLRDEGKILRKLVECINTYL
IRDGPNMGSRSLEIHDAVHQFLFRVWVTTHDRRLKDALVLYGRLQLKLVRGATDGSILLE
QLLDIIGKELDQISTSATSLPWNDTNRDDKRGTLTSSQSSLLELAAIVFCRACLISCKAP
VAEKRARREHAVVYLNEQIIKGKWSWNAAFCFLVRNYSSRIKHDHFIYWFEGLSTNFERM
MNAATMEHAYDDLLWTLRSLQGLSSVLLCSIYGVECSEKAELVNNQLYRGWLTIWNTLLR
GLPMFNNVPSVADAALILLGNINLSDSMNSFIIAHDVWDLRLFKNSPSVSLLRFIAGYFS
KKGSHDDLWDVLHLRKDLLRTVMTLLNWKERLVFNEQMAVLLPAAVFSLCAGSACFANCV
KGCSLAHLLVDIPVTVDDSMEVEKLEQESSHDLFDCSVEVLAEIFLDPYTETAQSPCDQK
VRLPRHLRDSLLHEMELNILEVLGNKEIEKMNLSDVFFLCALLSNFMYGSYVTRFKEENI
SFLSKTGQYILEMLGHAASIIEKCSSDVGYGSFGGLDGMDSILTSLKSFTGSPLFSYQED
DPPFYNDVIQSFERLLKALTKLYEGFSDGTNNLQSEIDQPGWSIPDISVQESRSSKHNKM
TVLDVELDADDDSKDVDIMSTGGENPRVSPNVSWKLDIISLISSFFSVLPVATWDVLFNL
IRIESDQRLMECLLFHLCQHPCWSSLQGFSDMVLSLDNMVDRLSDVKLQPTKILAAICGL
LQTLMSLNKVPKEKELTRSIKSGSAEQCTSQASMELILENDSQSLVPLGDLVNKIAENDQ
FDWSGRVKLIDCICNFVLLNPQISQAMIEKLLLMLRDPDFRVRFSLARRIGVLFQTWDGH
DELFQDILSNFSVKLVVLFKDKLVKAKEVLAAGHQPRPLMETIIVTLAHLALHSEKIELE
AVFMICVIAAIDSSQRYYFSTLVLMGKRLYIYFNCFTTGNWLVQYLIIYPENYNTAPDQR
SFKNKRDMSTCFYTSGSTGFFKVLKHQGDWNLNFLQYMGELIAPILFFWVHCGVSLAALV
ETRELFVLNVEASNFIQYSCHWLLPALVLHNDISSLNWVAKVAGQPSAALIKTQFVPIFS
VCIALHCSKRSGRESGTSVLQSSMLSISGISESERDTLIKRHMVSIVSHILSLSSRLSEP
ALPFFPKETIQRAIQTVVDGFLNMEPVPCSVVVMDKINIFRPDRVFMFILEMHHKITASI
HHRHRCNRLSGIEVLINVLGHRAAVPSTSNYLFNLVGQFIDYGPLQDQCCRIISTLLKTL
KDNQSKVGIDVLGEQLQFLVSKLVECCIASQSDFKHSRTRPSEALSLLHELVVDSDPSLH
KHIKELGPFPVFDIFDRIRKFHLELCQEYSARDHLLEFVRRSSCLPPRLVICSLKALHNI
MFTGFQPEKNARQFFGDAFWQYDHEVVHAVWTLVWMARSDATNSFGALVSDFLSMVSFLS
SFHFPFFFLHYIMPLIESSDKELFPVGLQIGIGDPHRVVFHLPGESNRIHVCRPLYSDSG
SGFSFRMDSGLSEELLIAVMRLLKKYLMDESVEIIEMASQALRGILSTERGHRALLSLDS
YERSILEVHSKGVNPELVQSSLMDLERKFNAQSISIEKATIWETRDKSFQTWICQLVYAL
IYFCDDTILRLCQDIALLKAEVAELLLSNIMVNLAKRKDLDIDLCKLISVKVVEEIVVES
NNLIRSVQVILDALNELRICHVMERATSVPSKNESSKYAKSSSYNSRSRCTPLKAKDHAA
TSSQSLTSTLLWEKVYWLPIDYLVVAKSAIGCGSYFTAVLYVEHWCQEHFNCLTLGSPDF
SHLEMLPHHIEILVSAVTQINEPDSLYGIIQSHKLTSQIITFEHEGNWSKALEYYDLQVR
SEASIEMGNSSGDVVPENFHSSLPSSSSKSEDEMRQRKPHKGLIKSLQQIGCTHVLDMYC
QGLMYRKGRFQDDLEFNELQFEAAWRAGNWDFSVLYMGANSPKAGQQIRHNHFNQRLHGC
LRAFQEGDINEFNLNLKESKQELLFSIYHASEESTEYIYSTIVKLQIFCHLGLAWDLRWA
WLDGKKDSHTDSQRLLSGPLIPNMDQLTWLNTEWSCILNRAQLHMNLLEPFIAFRRVMLQ
ILSCKDGTVQHLLESASILRKGCRFSQAAAALHEFKFLYIGMGGEDSKLYWLGRIEEAKL
LRAQGQHEMAINLAKYISERFKLNEEAADVYRLVGKWLAETRSSNSRTILEKYLKNAVTL
ANDHQATDKKSIARKSQTHFHLAHYADALFRSYEERLTSNEWQAAMRLRKHKTKELEALI
RRYKNSSKGEKTDYSVKIQELQKQLAMDREEAKKLQQDRDNFLSIALEGYKQCLVIGDKY
DVRVVFRLVSLWFGLCTRQIVVNGMLSTIKEVQSYKFIPLVYQIASRLGSSKDSQGPNTF
QFALVSLLKKMAIDHPYHTIFQLLALANGDRVKDKQSSRNSFVVDMDKKYAAESLLKELS
SYHEAVIRQMKQMVEIYIRLAELETKREDTNKKIALPRDIRSVRQLELVPVVTSSFPVDP
SCQYDEGSFPHFKGLADSVTIMNGINAPKVVECLGSDGKKYRQLAKSGNDDLRQDAVMEQ
FFALVNTFLQNHRDTWKRRLGIRTYKVVPFTPSAGVLEWVNGTLPLGEYLTGSTRNGGAH
GRYGIGDWSFPKCRQHMATENNKRKAFQEVCDNFRPVMHHFFLERFLHPADWFEKRLAYT
RSVAASSMVGYIVGLGDRHSLNILIDQATAEVVHIDLGVAFEQGLMLKTPERVPFRLTRD
IIDGMGVTGIEGVFRRCCEENLSVMRTNKEALLTIIEVFIHDPLYKWALSPLKALERQKE
TDDDLETSLEDSENEYEGNKDAARALLRVKQKLDGYEEGEMRSVHGQVQQLIQDAIDPDR
LCQMFPGWGSWL
NT seq 9399 nt NT seq  +upstreamnt  +downstreamnt
atggtcacatctggagatgtccaagagatcgtcttaaagctttcatctgataaagccaaa
gcccgtgaagaagggattaagttgttaaatacatggctagaaggagaaaggttgatcgaa
ttttgtagatatttaggacggaatacatcaatgctcaaacctcatgacataccacacgct
gaaacgtggccctttcttgttaaattgctcactaaagctatatcattggaggtatattca
agcaagaggcgcttgccgaaattggcatttgcaaaaactcttagaatcgtggtactaaga
gcagaagatggcaaaagtttgcatcttctatctgtggcaaagttacttttcaatcatata
tgggatattttaaaggatgttccaagcttccagtcagagtatggaattattctacggcat
cttttggaagttaaacatcttcagtttcacttgaggaagcgtgtgtattctagtctggtg
cttctgtacatgggaaaggttgagacaagcttgagtgagcgtaattttggacaatcaaat
cccaaggaggaggtctttcggtgcatcctcacgcttcattcacttcttgatagtcctcct
ggagatttttctaatgatcttcaggaaggaataacacaaggttttgttgagattttctct
aatttaagggatgaggggaagattttgcgcaaattagttgagtgtataaatacatatttg
attagggatggtccgaatatgggatctcgatccttagaaattcatgatgctgtacatcaa
tttctttttcgtgtttgggtaacgacccatgatcgtcgtctgaaggatgcccttgttttg
tacggcaggttacaattgaaattagtaaggggtgctactgatggcagtattttattggaa
caacttttggatataataggaaaggaactagatcaaattagtacttctgctaccagtctg
ccgtggaacgatacaaacagggatgataagcgaggtaccttgacaagctcacaatctagt
ttgctggagcttgcagctattgttttttgtcgggcatgccttatttcatgcaaagcacct
gtagctgaaaaacgagccaggagggagcatgctgttgtctatttaaacgaacaaatcatt
aaaggaaagtggtcttggaatgcagcattttgcttccttgttcgcaattactctagtcgc
ataaaacatgatcattttatctactggtttgaaggattatctacaaactttgagagaatg
atgaatgcagcaaccatggagcatgcttatgacgatcttctgtggactctacggagtctt
caaggactctcatcagttcttctctgttctatatatggagtggagtgctcagaaaaagcg
gaactcgtcaataatcagttgtacagaggctggcttactatatggaacactctactacgt
ggtttgccaatgttcaataatgttccatcagttgcagatgctgctcttatactccttgga
aatattaatttgagtgattcaatgaacagctttattatagctcatgatgtatgggatctc
cggttatttaaaaattccccatcagtgtctcttttacgcttcatagcaggctatttttcg
aagaaaggatcccatgatgatctgtgggacgttttacatttgagaaaagatctcttgagg
acggttatgacattgcttaattggaaggaacgtttggtgttcaatgagcaaatggctgta
ttgttgccagcagctgtattctctctttgtgctggttctgcttgttttgcaaactgtgtt
aaaggatgttctttggctcacctgcttgtagatatccctgtaactgttgatgacagcatg
gaggttgaaaaactagagcaggaaagttcacatgatctgtttgattgctctgtggaagtg
cttgctgaaatttttctcgacccttatacagagacagcccaatctccgtgcgaccagaag
gtgcgccttccccgtcatttgagggactctctgcttcatgaaatggagctcaacattctt
gaagttctaggaaataaggagattgaaaagatgaatctatcagatgttttctttctatgt
gctcttttgtcgaatttcatgtatggttcatatgttacaaggttcaaagaagaaaacatt
tctttcctttccaagactggtcagtacatcttagaaatgctgggtcatgctgcttctata
attgaaaaatgttccagtgatgtcggatatggttcttttggtggtcttgatggcatggac
tctatattaacttctttaaaaagttttactggttcaccgctctttagctatcaggaggat
gatcctccattttataatgatgttatccaatcatttgagagacttttgaaggctctgact
aaactatacgagggattttctgatggcacaaataatcttcagtctgagatagatcagcca
ggttggtctattccagacatttctgttcaagaatctcgatcatcaaagcacaataaaatg
acagtcttggatgtagagttggacgcagatgatgattccaaagatgttgatattatgagt
actggtggagagaatccccgagtgtctcctaatgttagttggaaactggacattatatca
ttgatctcaagctttttttcggttcttccagttgccacgtgggatgttttatttaattta
atacgaatagaaagtgatcaaaggctgatggaatgccttctgtttcacctttgtcaacat
ccttgctggtcctccctccaagggttttctgacatggttttatcactggacaatatggtt
gataggctttctgatgttaagcttcagccgactaagatactggctgctatttgtggcttg
ttacagacgttgatgtccttaaacaaagtaccaaaggaaaaagagctcactcgttctatc
aaatcagggtcagcggaacagtgcacatcacaagcttccatggagttaattctagagaat
gactctcagagtttggtaccactgggtgatcttgttaacaaaattgcagagaatgaccaa
tttgattggtctggtcgtgttaaactcattgactgcatatgcaactttgtattactgaat
cctcaaatcagtcaggccatgattgagaagctgctgttgatgctccgggatcctgacttt
cgagttcgattttctctagcaagaagaattggtgttcttttccaaacgtgggatggccat
gacgagctcttccaagatatactgtcaaattttagtgtaaaattggtggtgttatttaag
gataagcttgttaaagcaaaggaggttttagctgctggtcatcaaccgcgtcctttgatg
gaaaccatcattgtaaccctcgcacatcttgccttgcacagtgagaaaattgagttggag
gctgtttttatgatctgtgttattgctgcaattgattcttcccagaggtactatttttct
actcttgtgctgatgggcaaaaggctatatatttacttcaattgttttactacagggaac
tggttggtgcaatacttgataatctatcccgaaaactacaatacagctccagatcagaga
tcattcaaaaacaaacgagatatgtctacttgtttttatacttctggaagtaccggattt
ttcaaggttcttaaacatcaaggcgattggaatttgaattttctgcagtacatgggagag
cttattgcaccaattcttttcttctgggtccactgtggcgtaagcttagctgcactggtt
gagacacgggaactttttgttctaaatgtggaagctagtaatttcattcaatattcttgt
cattggcttcttccagctttggttttgcataacgacatttccagcttgaactgggttgcc
aaggttgccggtcaaccttctgcagctcttattaagactcaatttgtacctatcttttca
gtatgtatagcattacattgcagtaaaaggtctgggagggaatctggaacatcagtactt
caaagttcaatgttaagcatctcggggatatccgagagtgagcgggatacacttatcaag
agacacatggtttctattgtcagtcacattttatcactttcttcccggttatcagaacct
gcattacccttctttcccaaggagacgattcaacgtgcaattcaaacagttgtcgatggt
ttcttgaacatggaaccagttccttgcagcgtagtcgtaatggacaaaattaacattttc
cgccccgatagagtttttatgttcatacttgaaatgcatcataaaattacagcatcgatt
caccataggcacagatgtaacaggttgtctgggattgaggtgctcattaatgttcttggg
catagagctgcagtaccaagcacgtccaattatcttttcaacttggtggggcaattcatt
gattatggtcctttacaagaccaatgttgtcggatcatttctacactgctcaaaacactt
aaggacaaccaatccaaagtcggtattgatgtgcttggtgaacaacttcagtttctggta
tctaagttagttgaatgttgcattgcctcgcaatctgatttcaaacactcccgcactcga
ccatctgaggctttatcactactgcatgaacttgttgttgattctgatccatctcttcat
aagcatatcaaagaacttgggccttttcctgtatttgatatatttgatagaatacgtaag
ttccaccttgaactatgccaagagtactcagcaagagaccacttattagagtttgtgagg
agatctagttgtcttccaccacggttggttatatgcagtctcaaggcgttgcacaatatc
atgttcacagggtttcagcctgaaaagaatgcaagacaattttttggagatgcattttgg
caatatgaccatgaagttgtacatgcggtttggactctagtctggatggccaggtcagac
gcaacaaacagttttggagcacttgtttctgactttttatcgatggtctcattcttaagc
tcctttcatttccctttcttcttcctgcactatattatgccattgatagaatcaagtgat
aaagaattatttcctgttgggctccagatcggcattggggatccacatcgcgttgttttc
catcttcctggagagtcaaaccggatacatgtgtgtcggcctctttattctgatagtggt
agtggctttagttttcgtatggattcaggtttatccgaagagctcttaattgcagtgatg
cggcttttgaagaagtatttgatggatgaatctgttgagataattgagatggcatctcaa
gcattacgtgggatactttcaactgaaaggggtcaccgagctttactatcacttgattct
tatgagaggtctatacttgaggttcattccaagggtgttaatccggagctagttcagagt
tctttaatggatctagaaaggaagttcaatgctcaatccatttccattgagaaggctact
atatgggagactcgtgacaaatcctttcagacatggatctgtcaactagtttatgccctg
atatatttttgtgatgatactatcttaaggttatgtcaggatattgcgttgctgaaagct
gaagttgcggagcttcttttgtcaaatattatggtcaatcttgcaaagaggaaggatttg
gacattgatctgtgcaagttgatctctgtgaaggtggtggaggagatagtcgtagagtcc
aataacttaattagatcagttcaggttattttggatgcactcaatgagcttcggatatgt
catgtaatggagagggctacttctgttccatctaaaaacgaaagctcaaagtatgcaaag
tcatctagttataactctagatcccgttgtacaccacttaaggcgaaggaccatgctgca
acgtctagtcaatcgctgacatctactttgttgtgggaaaaggtttattggcttcctatt
gactaccttgttgtcgctaaatcagccattggctgtggctcatactttacagctgtcttg
tacgtggagcattggtgtcaagagcatttcaactgtctcacgttagggagtccagatttt
tcccatctagagatgctgccgcaccacatagaaattctagtctcagcagttacccaaata
aacgaaccagacagtttgtatggaatcatccagtctcacaagctgacatcacaaataatc
acttttgagcatgagggtaactggagtaaagctctggagtattatgatctacaagtacga
tctgaagcatcgattgagatgggtaatagttccggggatgttgtacctgaaaattttcat
tcgtccttaccttcatcttcctccaagtccgaagatgaaatgaggcaaagaaaaccacac
aaagggctgattaaatctttgcagcaaattggttgcactcacgtattggatatgtattgc
caaggattaatgtatcggaaaggccggtttcaggatgacttagaattcaatgagctacag
tttgaagctgcttggcgtgcaggaaattgggatttctctgtactgtacatgggtgctaat
tctcccaaggcaggtcaacagatcagacacaaccatttcaaccaaaggctacatggctgt
ttgagggcttttcaagagggagatatcaacgaatttaacctgaacctgaaagaatctaag
caggagcttctattctcgatctatcatgcaagtgaggagagcacggaatatatatattcc
actattgtgaagcttcagattttctgtcatcttgggcttgcctgggatttgcgatgggca
tggttggatgggaagaaagatagtcacactgattcacagagattgttatctggacctctt
attcccaacatggatcagttgacatggttgaatacggaatggagttgcattctgaaccgt
gcacagttacatatgaaccttttagaacctttcattgcattcagaagagttatgcttcaa
attttgagctgtaaggatggtacggtccaacatcttttggaatctgcatcaattcttcgt
aagggatgtagattttctcaagctgctgcagctttgcatgagtttaagttcctctacatt
ggcatgggaggagaagattctaaactgtattggcttggaaggattgaagaagcaaagctt
ttgcgagcccagggtcagcatgagatggcaattaatcttgcaaagtacatctccgaacgc
tttaagttaaatgaggaagcagcagatgtatatcgtctagttgggaagtggctggctgaa
acacgctctagcaactctaggactatcttggagaagtatctgaaaaatgcagttaccctt
gctaacgatcaccaggctacagacaagaagtccattgcaagaaaaagccaaacacatttc
catcttgctcattatgccgatgctctatttcgtagttatgaggaaagactaacctctaat
gagtggcaagcagcaatgcgcttgagaaaacataagacaaaagagctggaggcactaatt
agacgatacaagaattcatccaagggtgagaagacagattattcagtaaaaatacaagag
ctgcaaaaacaacttgcaatggacagggaggaggctaaaaagttgcagcaagacagggat
aatttcctcagcattgcacttgaaggatataagcaatgtctggtcattggggacaaatat
gatgtacgagtggtttttcgacttgtatctctgtggtttggtttatgcacaagacaaatt
gttgtaaatggaatgctcagtacaatcaaagaggtgcaatcttacaagttcataccccta
gtataccaaattgcttcaaggctgggtagctcaaaagatagtcagggacctaatactttt
cagtttgctttggtttctctattaaagaaaatggcaattgatcatccatatcacacaatc
tttcagcttttggcactcgcaaatggtgaccgtgtcaaggacaagcagagcagtagaaac
tcatttgtggtggatatggataaaaagtatgctgctgaaagccttctaaaagagttatct
tcatatcacgaagctgtaattagacaaatgaagcagatggtagaaatctatatcagactt
gctgaactagaaacaaaacgagaggataccaataaaaagattgctctaccaagagatatt
cgcagcgttcggcaacttgaactcgttcctgtagtgacatcaagttttccagttgaccct
agttgtcagtatgatgaagggtctttcccgcatttcaaaggtttagcagattcagtcacg
atcatgaacggcataaacgctccaaaagttgttgagtgcctcggttcagatggtaaaaag
tatcggcagctagcaaaatctggaaatgatgacctgagacaagatgctgtaatggagcag
ttctttgccttggtcaacactttcttacagaaccacagggatacatggaaaaggagatta
gggatacggacatacaaggtggttccttttactccaagtgctggtgttcttgagtgggta
aatggcacattacctttaggcgaataccttacaggaagtacgagaaatggaggtgcccat
ggacgttatggaataggagattggtcatttcccaaatgtaggcagcacatggctacagaa
aataacaagcgtaaggcattccaagaagtctgtgataatttcagaccggtcatgcatcac
tttttcctagaaagatttttgcatccagctgactggtttgaaaaacggcttgcttataca
agaagtgtcgcagctagttcaatggtcggttacattgtgggtcttggagatcggcattcc
ttgaacatcttaattgatcaagcaactgcagaagttgtgcacattgatcttggtgttgcc
tttgagcaagggttgatgctgaaaacacctgagcgggtcccattcagactgacgagggac
attattgatggtatgggggtgactggtattgaaggggttttcagaaggtgttgtgaagaa
aatctttcagttatgcgaacaaataaagaagctttgctgaccatcattgaagtttttatc
catgatcctttatacaagtgggctctatcacctctaaaggctttggagcgccaaaaggaa
actgatgatgatctggagacaagcttggaggactctgaaaatgaatatgaaggaaataaa
gatgcggcacgtgctcttctgcgtgttaagcagaagcttgatggatatgaagaaggcgaa
atgaggagtgtgcatggacaggttcaacaattgatacaggacgcaatcgatcccgatcgc
ctgtgtcagatgtttccgggatggggatcgtggttgtag

DBGET integrated database retrieval system