KEGG   Cynara cardunculus var. scolymus (artichoke): 112513840Help
Entry
112513840         CDS       T05604                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00480  Glutathione metabolism
ccav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    112513840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccav02000]
    112513840
Enzymes [BR:ccav01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     112513840
Transporters [BR:ccav02000]
 Other Transporters
  Pores ion channels [TC:1]
   112513840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_2 GST_N_2 GST_C_3 GST_C_5 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 112513840
NCBI-ProteinID: XP_024975982
LinkDB All DBs
Position
LG 5
AA seq 222 aa AA seqDB search
MGKDDVKLLSMWASPFCMRVKVALAEKDVAYEEILESDLMGAKTELLIKSNPVHKQVPVL
LHDDKPVVESTNILTYIDEVWPAKPLLPACAYGKSRARFWADYIDRKVFPAGRNVWTAKE
DDQVESARKEFLDILMYLDGTLGEQDYFNGDTFGFVDILLIGLTSWFPAFEKYGGFKVED
EYPKLAAWITRSYARETVSESLTSPEKITNFVGMMRQMYGIE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagatgatgtgaagctgttgagcatgtgggcaagcccattttgcatgagagtg
aaggttgcattggctgaaaaagatgttgcttatgaggagattttagagagtgatttgatg
ggtgccaagactgagttgttgatcaaatctaaccctgtccataaacaggtgcctgtgctg
ttgcacgatgataagcccgtggtcgagtccaccaacatcctcacctacatcgatgaagtt
tggcctgcaaaacccttgttgcccgcttgcgcgtatgggaaatcccgagccaggttctgg
gccgactatattgatcgcaaggtgtttccggccggtcgtaacgtttggaccgcgaaagaa
gatgaccaagtagaaagcgctaggaaggaattcctcgatatcttgatgtacttggacgga
actctgggcgaacaagattactttaacggcgataccttcggatttgtggacattctgctc
atcggtctaacctcatggttccccgcctttgagaagtacggtgggttcaaggtggaggat
gagtacccgaaattggcagcatggatcacacgatcctacgctagagaaacggtttcggaa
tcgttaacgagcccagaaaagatcaccaactttgtagggatgatgaggcagatgtatggc
atcgaatag

DBGET integrated database retrieval system