KEGG   Cynara cardunculus var. scolymus (artichoke): 112514700Help
Entry
112514700         CDS       T05604                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00250  Alanine, aspartate and glutamate metabolism
ccav00410  beta-Alanine metabolism
ccav00430  Taurine and hypotaurine metabolism
ccav00650  Butanoate metabolism
ccav01100  Metabolic pathways
ccav01110  Biosynthesis of secondary metabolites
Module
ccav_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    112514700
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    112514700
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    112514700
   00430 Taurine and hypotaurine metabolism
    112514700
Enzymes [BR:ccav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     112514700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 112514700
NCBI-ProteinID: XP_024977069
LinkDB All DBs
Position
LG 1
AA seq 490 aa AA seqDB search
MVISTTIADYDQNLHSTFASRYVRTSLPRFKMPDQPIPKDAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMIARLFHAPIGEDDTAVG
VGTVGSSEAIMLAGLAFKRKWQAKRKSQGKTCDNPNIITGSNVQVCWEKFASYFEVELKE
VKVKEGYYVMDPVKAVELVDENTICVAAILGSTMTGEFEDVKLLNELLTKKNEETGWNVP
IHVDAASGGFVAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRTKDDLPDEL
VFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYRDVMKNCNGNVTVLKEGLEK
TGRFNIISKDVGIPLLAFSLKDSSRYTVFDISESLRRFGWIVPAYTMPPDAQHILVLRVV
IREDFSHSLADRLIADIVKVVNEMEDAQSIASMSHAHDGTPSDRSTREMQRGITKYWRRF
VHGKKTSSVC
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcagcacgacgatcgccgattatgatcaaaacctacactctactttcgcttct
agatatgtccgtacatctcttccaaggtttaagatgcccgatcaaccgataccgaaggat
gcggcatatcagataataaacgatgagttgatgctcgatggtaatccgaggctaaacttg
gcgtcatttgtgacgacgtggatggagccagagtgcgataaacttatcatgtcatctatc
aacaagaactacgttgacatggacgagtatcccgtcaccaccgaacttcagaacaggtgc
gtaaacatgatcgctcgactgttccatgctccaatcggagaagacgatactgctgtcggt
gtgggaacggttggatcatcggaagcgataatgctcgccggtctcgctttcaaacggaaa
tggcaggccaagagaaaatcgcaaggaaaaacttgcgataaccccaatatcatcaccgga
tcgaatgtgcaggtctgctgggagaagtttgcgagctattttgaggtcgaattgaaagag
gtgaaagtgaaagaaggatactatgtgatggatcccgtgaaagcggtcgaattagtggat
gaaaacacgatctgtgtggctgcgattcttggttcgacgatgaccggagagtttgaagac
gttaagcttcttaacgagcttttaacaaagaaaaacgaagaaacaggatggaacgtcccg
attcacgttgatgctgcaagtggagggtttgttgccccttttctgtaccccgatcttgaa
tgggattttcgtttgccgctcgtgaagagcatcaacgtcagcggtcacaagtacgggctc
gtatacgccggcgttggttgggtcgtttggcggacgaaagacgacttgccggacgagctc
gtgtttcatataaattacttgggatctgatcaacctaccttcactctcaacttctctaaa
gggtcgagccagataattgcgcagtactaccagttcatacgacttggcttcgagggttat
cgggatgtcatgaagaactgtaacggaaacgtaacggtgcttaaagaagggttagaaaag
actgggagatttaatataatctctaaagatgttggcattcctttactagcgttttcgctt
aaagacagttcaagatacactgtgttcgatatatccgagtctctgagacgattcggatgg
atcgttccggcatacaccatgccaccggatgcgcaacatattttggttctcagagtcgtg
attcgtgaagatttcagccacagtctagctgatcgactaattgcggatatcgtcaaagtg
gttaacgagatggaagatgcacaatcaattgcgagcatgagccatgcacatgatggcacg
cccagtgatcgtagcacaagggagatgcaacggggaataaccaaatactggcggcgattt
gttcatggtaagaaaacgagtagcgtctgctag

DBGET integrated database retrieval system