KEGG   Cynara cardunculus var. scolymus (artichoke): 112515488Help
Entry
112515488         CDS       T05604                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00020  Citrate cycle (TCA cycle)
ccav00190  Oxidative phosphorylation
ccav01100  Metabolic pathways
ccav01110  Biosynthesis of secondary metabolites
ccav01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    112515488
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    112515488
Enzymes [BR:ccav01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     112515488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 FAD_binding_3 GIDA DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 112515488
NCBI-ProteinID: XP_024978105
LinkDB All DBs
Position
LG 7
AA seq 629 aa AA seqDB search
MWRCVSRAIRIPSRRSTSGDFLSRRFFSSESNVGRSAYTIVDHTYDAVVVGAGGAGLRAA
IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD
AIQYMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCACAADRTG
HALLHTLYGQAMKHNTQFFVEYFALDLLMGSDGSCQGVIALNMEDGTLHRFRSSSTILAT
GGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRGEGG
ILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPMKDHIYLHLNHLPPEVL
KERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGNDPDAIIPGL
MAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIHRPGEKQKPLEKGAGEKTIAW
LDKIRNSNGSLATSKIRLNMQRIMQNNAAVFRTQETLEEGCNLIDKAWESYHDVKLKDRS
LIWNSDLLETIELENLLINACITMHSAEARKESRGAHAREDFSKRDDEKWMKHTLGYWEN
EKVRLDYRPVHMNTLDDEVETFPPKARVY
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtgtcacgtgcgattcgcattccttcccggagatccacctccggcgac
tttctttcacgcagattcttctcttctgaatcgaatgtggggcggtcagcatatacaata
gttgatcatacatacgacgcggttgtggttggagcaggaggtgctggtctcagagctgcg
atagggctatctgagcatggatttaatactgcttgcattaccaagttgttcccaacacgc
tctcacactgttgcagcgcagggtggtataaatgctgcattaggaaatatgaccgaggat
gactggaggtggcacatgtatgacacagttaagggaagtgattggctaggtgaccaagat
gctatccagtatatgtgtagagaagcaccaaaagcagttattgagcttgaaaattatggt
ttgccattttctcgaactgaagagggaaagatataccaacgtgcatttggtggtcagagt
ctcgactttggcaaagggggccaagcttatcgttgcgcctgtgctgctgatagaaccggg
catgcattgttgcatacattatatggacaggccatgaaacacaatacacagttctttgta
gaatattttgctttggatctactcatgggtagtgatggtagctgccaaggtgttattgcg
ctgaacatggaggatgggacactacatcggttccgctcttcgtcaacaatcttggcaacg
gggggttatggtagagcatatttctcagcaacctctgctcatacttgcacaggagatgga
aatgctatggttgcacgtgcaggccttcctcttgaggatcttgagtttgtacaatttcat
ccaactggtatatacggtgctgggtgcctcattactgaaggatctcgcggtgaaggtggt
attctaaggaatagtgaaggcgaaagatttatggaacgatatgcccctacagcaaaggat
cttgcatcaagagatgttgtttcaagatctatgaccatggaaatccgagaaggtcgtggt
gtagggccaatgaaggaccacatttatcttcacttgaatcacctaccaccagaggttctc
aaggagaggcttccagggatctctgaaactgctgccatctttgccggcgttgatgttaca
aaggagccaattccagttttacccactgtgcattataatatgggcgggatcccaactaat
taccatggggaggttgttaccatcaaggggaacgatcctgatgctattattcccggactt
atggctgctggagaggcagcctgtgcctccgttcatggtgccaatcggcttggtgcaaat
tctcttcttgatattgttgtttttggtcgagcctgtgcaaatagagttgcagagatccat
agaccaggggaaaaacaaaaacctttggaaaagggtgctggagagaagactattgcatgg
ttagacaagatcaggaattcaaatggttcacttgctacctccaagatcaggttgaatatg
cagcgaatcatgcaaaacaatgctgctgtatttcgcacacaggagacgttagaagaaggt
tgcaatctgattgacaaagcatgggagagctatcatgatgttaaactgaaagaccgaagc
ttgatatggaactcggacttgttagagaccatagagttggaaaacctcttgattaatgca
tgtatcaccatgcattcagctgaagctaggaaggagagcagaggagctcatgcccgtgaa
gatttttcgaaaagagatgatgagaaatggatgaaacacacactgggatactgggagaac
gagaaggtacgactagactacaggccggttcacatgaatactctcgatgatgaggtcgag
actttcccacccaaggcccgtgtatactaa

DBGET integrated database retrieval system