KEGG   Cynara cardunculus var. scolymus (artichoke): 112515933Help
Entry
112515933         CDS       T05604                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    112515933
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccav03036]
    112515933
Enzymes [BR:ccav01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     112515933
Chromosome and associated proteins [BR:ccav03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     112515933
   Polycomb group proteins
    PRC2-EZH2 complex
     112515933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 112515933
NCBI-ProteinID: XP_024978680
LinkDB All DBs
Position
LG 7
AA seq 926 aa AA seqDB search
MSSPKVPPLSSTAAGRSDSPDVSTIVGPQGAAIAPSEISLVIDSLKKKVDADRCVYIMKR
MEENRIKLSEVTHTHHKLSLERRHLRISGADQTVDLLTKRQKDAIDKQNGVNASNGDSDS
TSSQEDGHASAILLGSSIAVKNAVRPIKLPEVKKLPPYTTWIFLDRNQRMTEDQSVVGRR
RIYYDQNGGEALICSDSEEEAIDEEEEKKEFVDSEDYIIRMTIQQLGSSDAVLDLLGQRL
SRKPSELKARYEVLVNRENAVEGSKPGNVEFDMSSLFDKDLEAALDSFDNLFCRRCLVFD
CKLHGCSQDLIFPAEKHSTWNRMDEEKLPCGPHCYYRVQKVEGTAVTSSMQPNSEQKAAL
SSDGNGVQASRKKSNGRSLLRRLKSCQSENASSNARNISESSESETRPVHDGNSTYRLPS
PRKSKLVEKRGTRQRNSKRIADHVMVAIKKRQKKLAASDSDSVPSGSLGSKDMGVRSNSH
KENEEASSSSLKAKPSARRGRRKDSLVPSGDRSLQAEVPDCALKEITSDQPVISSDDKWK
KEEFVDESICRQELIEFKCWRTIEKSLFEKGLEIFGRNSCLIARNLMNGMKTCAEVFYAM
NCSENKLSSQGGDGTNSLGDGSRIDSNENTGTALRRRSRFLRRRGKVRRLKYSWKSAGYH
SMRKRISDKKELPCRQYNPCGCQSACGKECSCLVSGTCCEKYCGCPKTCKNRFRGCHCAK
SQCRSRQCPCFAAGRECDPDVCRNCWIGCGDGTLGIPGQRGDNYECRNMKLLLKQQQRVL
LGRSDVSGWGAFLKNSVPKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQYVL
DAYRKGDKLKFANHSPVPNCYAKVIMVAGDHRVGIFAKERICAGEELFYDYRYEPDRAPA
WAKKPESSGSKKEEMGPSSGRAKKLA
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgccgaaggtccctcctctatcatccaccgccgccggcagatcggactctcca
gatgtatctacgattgtgggaccacaaggagcagctatagctccttcagagatttcattg
gttatcgactcgttgaagaagaaagttgatgctgatcgttgtgtttatatcatgaaaaga
atggaagagaaccggattaagttgtctgaagtcacccacactcatcacaagttatcatta
gaaagaaggcatctaaggatttctggtgctgatcaaactgttgatttgttgacaaagagg
cagaaagatgcaatagataagcagaacggcgtcaatgcaagcaatggtgacagtgacagc
actagctctcaggaagatggacatgcttcagcaattctcctaggttctagcattgcagta
aaaaatgctgtcaggccaatcaagcttccagaagtgaagaaattacctccttatactaca
tggattttcttggatagaaatcagagaatgacagaagaccagtctgtagttggtcgaagg
agaatttattatgatcaaaatgggggtgaagctctaatttgcagtgacagtgaagaggaa
gcaattgatgaagaagaggaaaagaaagagtttgttgactctgaagattacatcattcga
atgaccattcaacaacttgggtcatctgatgctgttttggatttactggggcagcggttg
tctagaaaaccttcagaactcaaagcaaggtatgaagtccttgtgaacagagagaatgct
gttgaaggctctaaaccaggaaatgttgagttcgatatgagttcattgtttgataaagat
cttgaagcagcactggactcatttgacaacctcttctgtcgccgatgccttgtatttgat
tgtaaattacatgggtgctcacaagaccttatatttcctgctgaaaagcattctacctgg
aaccgcatggatgaggaaaagctaccttgtggtccccattgttattatcgggtccaaaag
gtggaaggcactgccgtaacatcttctatgcagcccaatagtgaacaaaaggctgctctt
tcatcagatggtaatggtgttcaggcatcaagaaaaaaatccaatggccggtctctattg
aggaggttaaagtcttgccagagtgaaaatgcttcatcaaatgctagaaacatatctgaa
agcagtgagtctgagactaggccagttcatgatgggaattctacttatcgtcttccttca
ccacgtaagagtaaacttgttgagaaacgtggaactcgtcaaaggaatagcaaacgtatt
gctgatcatgttatggttgcaataaagaaaagacagaagaagctggctgcttctgattct
gattctgttcccagtggaagtcttggctcaaaagatatgggggttcgatccaattcacat
aaagaaaatgaagaagctagttcatcctctctgaaggcaaaacccagtgccagaaggggt
aggcggaaagattcattggtccctagtggtgatagatctcttcaggctgaagttcctgat
tgtgcattgaaggagatcaccagtgaccagccagtgatcagtagtgatgacaaatggaag
aaagaagagtttgtggatgagagtatctgcagacaagaattgattgagttcaaatgttgg
agaactattgaaaaatctctctttgaaaaaggtctggagatctttggcagaaacagctgt
ttaatagctaggaatcttatgaatggaatgaagacatgtgcggaggtgttttatgctatg
aattgctctgagaataagctatcttctcaaggtggagacggcacaaattctctaggcgat
ggatccagaattgatagtaatgagaatacgggtactgcactaagaagaagatctagattt
ttacgcagaagaggtaaagttcgtcgcttaaagtattcctggaagtctgctggataccat
tcaatgaggaaacgtatctctgataaaaaagagctgccttgtcgccaatacaatccatgt
gggtgccaatctgcttgtggaaaggagtgttcttgccttgtcagtgggacttgctgtgaa
aagtactgcggatgtccgaaaacatgcaaaaatcgttttagaggatgccattgcgctaaa
agccagtgtagaagtcgtcaatgcccttgctttgctgctggtagagaatgtgatccagac
gtgtgcagaaattgctggatcgggtgtggagacggtactctaggtattccaggtcaaaga
ggtgataattacgaatgtagaaatatgaagcttctcctcaaacaacaacaacgggtttta
ctaggaaggtccgatgtttctggttggggagctttcttaaagaatagcgtacctaagcat
gaatacctgggtgagtacaccggagaattgatctcacatcgtgaagctgacaagcgtgga
aagatctacgatcgtgaaaattcgtctttcctcttcaaccttaacgatcaatatgttctt
gatgcttatcgtaaaggtgacaaattgaagtttgctaatcattctccggtcccaaattgt
tatgcaaaggttataatggtggctggagatcatagggtcgggatatttgctaaagaaaga
atatgtgctggggaagaactgttttacgactaccgttatgaaccagatagggctccggct
tgggcaaagaagccggagtcatctggttcaaaaaaagaagagatgggtccatcgagcggg
cgtgctaagaagcttgcttga

DBGET integrated database retrieval system