KEGG   Cynara cardunculus var. scolymus (artichoke): 112516720Help
Entry
112516720         CDS       T05604                                 

Definition
(RefSeq) uncharacterized protein LOC112516720
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00061  Fatty acid biosynthesis
ccav00780  Biotin metabolism
ccav01100  Metabolic pathways
ccav01212  Fatty acid metabolism
Module
ccav_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    112516720
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    112516720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccav01004]
    112516720
Enzymes [BR:ccav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     112516720
Lipid biosynthesis proteins [BR:ccav01004]
 Fatty acid synthase
  Component type
   112516720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-GeneID: 112516720
NCBI-ProteinID: XP_024979692
LinkDB All DBs
Position
LG 8
AA seq 224 aa AA seqDB search
MASKALLSQINSPSPNSNPSPETFSFNRCSLPTVSRPPLLSTQLKTNQSSFIANCSSAST
DRPKDETPIELRFPAFPTVVDINQIRDILPHRFPFLLVDRVIEYNPGVSAVGIKNVTIND
NFFPGHFPERPIMPGVLMVEAMAQVGGLVMLQPEMGGSRDSFFFAGIDKVRFRKPVVAGD
TLVMRMTLIKLQKRFGIAKMEGKAYVGGEIACEGEFLMAMGSSE
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaagctctcctttctcagatcaattctccctcccctaactctaacccaagc
cctgaaaccttttctttcaatcgctgctcacttccaactgtctccagaccccctctcctg
tcaacccaattgaagaccaaccaaagcagtttcattgccaactgttcttcagcttcgact
gatcgcccaaaagacgaaaccccaattgaactcaggttccctgcctttccaactgttgtt
gatatcaatcagattcgagacattttgccacatcggtttccatttcttttggtggatagg
gttattgagtataatccaggagtttcagccgttggaatcaagaatgtgaccattaatgac
aacttctttcctgggcattttcctgagaggccaattatgcctggtgttctcatggttgag
gcaatggctcaagttggtggtttggtaatgctgcagccagaaatgggaggctcacgtgac
agtttctttttcgctggaattgacaaggtgaggttcaggaaaccagtggtcgccggagac
actttggtaatgagaatgacactcatcaaacttcaaaaacgctttggaatcgcaaaaatg
gagggaaaggcgtatgttggaggtgagatcgcttgcgaaggtgagttcttgatggctatg
ggtagtagtgagtga

DBGET integrated database retrieval system