KEGG   Cynara cardunculus var. scolymus (artichoke): 112518260Help
Entry
112518260         CDS       T05604                                 

Definition
(RefSeq) protein cornichon homolog 1-like isoform X1
  KO
K20368  protein cornichon
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Brite
Membrane trafficking [BR:ccav04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    112518260
Transporters [BR:ccav02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   112518260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cornichon ODV-E18
Motif
Other DBs
NCBI-GeneID: 112518260
NCBI-ProteinID: XP_024981661
LinkDB All DBs
Position
LG 9
AA seq 163 aa AA seqDB search
MVWEVFLWVIFFIIIMALIASNLYQIVCLSDLEADYMNPYESSSRINAVVVPEMVLHGLC
SALLLVTGYWFMFLLTLPITIYNSMLYMNRQHLIDVTEVFRYVDAEKKYRIAKLALYLFL
FVLVVIRMVIVMVTVIINNVIGDDDERLPGFRFDFFDSRRFMS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgggaagttttcttgtgggtcatcttcttcatcatcatcatggccctcatcgcc
tctaatctctatcagattgtgtgcctatccgatttggaggctgactatatgaacccgtat
gaatcatcatcgcgcattaatgctgtggttgtccctgaaatggttctccatggtttatgc
tctgctcttcttcttgtgacgggctactggttcatgttccttcttacacttccgatcact
atctataattccatgttatacatgaatcgacaacatcttatagatgtaactgaagttttc
agatatgtcgatgctgaaaaaaagtatcggattgccaaactggccttgtacttatttctc
tttgtcctagtggttatcaggatggtaatagtgatggtaacagtgattatcaacaatgta
ataggtgatgatgatgaaagattacccgggttccggtttgactttttcgattctcgccgg
tttatgtcatga

DBGET integrated database retrieval system