KEGG   Cynara cardunculus var. scolymus (artichoke): 112518957Help
Entry
112518957         CDS       T05604                                 

Definition
(RefSeq) hexokinase-2, chloroplastic
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00010  Glycolysis / Gluconeogenesis
ccav00051  Fructose and mannose metabolism
ccav00052  Galactose metabolism
ccav00500  Starch and sucrose metabolism
ccav00520  Amino sugar and nucleotide sugar metabolism
ccav01100  Metabolic pathways
ccav01110  Biosynthesis of secondary metabolites
ccav01200  Carbon metabolism
Module
ccav_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccav_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112518957
   00051 Fructose and mannose metabolism
    112518957
   00052 Galactose metabolism
    112518957
   00500 Starch and sucrose metabolism
    112518957
   00520 Amino sugar and nucleotide sugar metabolism
    112518957
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    112518957
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccav04131]
    112518957
Enzymes [BR:ccav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     112518957
Membrane trafficking [BR:ccav04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    112518957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Alpha_L_fucos
Motif
Other DBs
NCBI-GeneID: 112518957
NCBI-ProteinID: XP_024982547
LinkDB All DBs
Position
LG 1
AA seq 499 aa AA seqDB search
MSFAVNPPPAVRSFPFSRSPIGRTPRVSMVVRSGAGVPIATAAALPILTKLQNDCATPLP
VLRHVADAMATDMRAGLAVDGGSDLKMILSYVDSLPTGNERGLFYALDLGGTNFRVLRTQ
LGGKDDRVIATECDQVSIPQDLMFGTSEELFDFIASALAKFAQKEGGKFVLPDGRSRETG
FTFSFPVKQTSIDSGILIKWTKGFAVSGTPGKDVVACLNEAMKRQGLDMRVSALVNDTVA
TLAGARYWDNDVMVAVILGTGTNACYVESVDAIPKLNGQKTTSGRTIVNTEWGAFSNGLP
LTEFDREMDAESINPGEQLFEKTISGMYLGEIVRRILVRMAESGSLFGKHVPERLRTPFT
LGTPNISSMQQDTSEDLEAVGSILYEATGVDSNLDARKMVVEVCDTIAKRGGRLAGAGIV
GILQKMEEDSKGIVFRKRTVVAMDGGLYEHHPQYRRYLKDAVTELLGPELSNNVVIEHSK
DGSGIGAALLAATNSIYEH
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcgccgttaacccaccgccggccgtccgatccttccccttctctcgatcaccc
attggccgcaccccacgtgtctccatggtcgtgcgttccggcgccggtgttccaatcgcc
accgccgctgcactccctatcttgacgaaattgcaaaacgactgcgccacccctctcccc
gtcctccgccacgttgccgatgccatggctactgatatgcgagccggcctcgccgttgac
ggcggcagtgatcttaagatgatccttagctacgttgattctttgccaactgggaatgaa
agagggttgttctacgcattggatctcgggggtacgaatttccgagttcttagaactcaa
ttaggtggaaaagatgatcgggtgatcgccacagaatgtgatcaagtttcaatcccacaa
gacttgatgtttggcacttctgaggaacttttcgactttatcgcttctgcattagcaaaa
ttcgcacagaaagagggcggaaagtttgtgctgccggatggtagaagtcgagagacgggg
tttactttctcttttccggtgaagcaaacctccattgattccgggatactgatcaaatgg
acaaagggtttcgcagtctcgggaacgcccgggaaggatgttgtcgcttgtttaaatgaa
gctatgaagagacaagggctcgatatgcgggtgtcggccttggttaatgatacagtggca
acactagccggagcgagatactgggataacgatgtcatggttgccgtaattctcggaacg
ggaaccaatgcttgctatgtagaatctgtggacgccattccgaaactaaatggacagaaa
acaacctctggaagaacgatcgtcaataccgaatggggagcgttctcgaacggtcttcca
ttgaccgagttcgatagggagatggatgcggagagtataaaccccggtgagcagttgttt
gaaaaaacgatctcgggtatgtatcttggcgaaattgtgagacggatactcgtgaggatg
gcagaatcaggctcgttattcggaaagcatgttcccgaaagactaagaaccccgttcaca
ctcgggaccccaaatataagttctatgcagcaggatacttctgaagatcttgaagctgtt
ggatccatcctttatgaagcaactggggtggactcaaatttggatgcgaggaagatggtg
gtggaggtctgtgacacgatcgcaaagcgtgggggccggttggctggagcgggaattgtg
gggatactccaaaagatggaggaggattctaagggaatcgtgtttagaaagcgtacggtt
gttgcaatggacgggggtttatacgaacaccaccctcagtatcgcagataccttaaagat
gcggtaacggagcttttagggccggagttatcgaacaatgtggttatcgagcattcgaaa
gatggatcgggcattggagctgctctcttagctgctacaaattcgatttacgaacactaa

DBGET integrated database retrieval system