KEGG   Cynara cardunculus var. scolymus (artichoke): 112520335Help
Entry
112520335         CDS       T05604                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav03030  DNA replication
ccav03410  Base excision repair
ccav03420  Nucleotide excision repair
ccav03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    112520335
   03410 Base excision repair
    112520335
   03420 Nucleotide excision repair
    112520335
   03430 Mismatch repair
    112520335
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ccav03032]
    112520335
   03400 DNA repair and recombination proteins [BR:ccav03400]
    112520335
Enzymes [BR:ccav01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     112520335
    6.5.1.6  DNA ligase (ATP or NAD+)
     112520335
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     112520335
DNA replication proteins [BR:ccav03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    112520335
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     112520335
DNA repair and recombination proteins [BR:ccav03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     112520335
   NER (nucleotide excision repair)
    Other NER factors
     112520335
   MMR (mismatch excision repair)
    Other MMR factors
     112520335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 112520335
NCBI-ProteinID: XP_024984452
LinkDB All DBs
Position
LG 10
AA seq 799 aa AA seqDB search
MLSLRSCCYSAAYTNVHSRPIGHSLLKLSHPLSLPSPFLFLIQSAKYSNRMSSSRPSAFD
ALMSNARAAAGKKKTQSSSPSPKKRKTLDSKSPINSTSISDAKPPEVSPKPEKTLDVKQI
KEESNLSNGSKQNEPNPNLASSEEEKASKKPRVINVDESIAQLKKAAANFDPQKAAFWGE
GERVPFLFLVRVFDAISKESGRIVITGIVCNMLRTVIKTTPDDLLPVVYLLANRIAPAHE
GLELGIGDASIIKALAEACGAKEAHIKKQYKELGDLGLVAKASRSSQPLMRKPQPLTVTK
VFDTFRVIAKESGKDSQDKKKNHIKGLLVAATDCEPQYMIRLLQTKLRIGLAEQTLLTAL
GHAIFYTEKHPSPPVHTDSPLEEAAKIVKQVYSVIPVYDKIVPALLSDGVWNLPKTCCFS
PGVPVGPMLAKPTKGVSEILDKFQDMEFTCEYKYDGERAQIHYMEDGTVQIYSRNAERNT
EKFPDVVVAASRVKKPSVTSFVLDCELVAYDHKKQKILPFQILSTRARKNVVMSEIKVDV
CIYAFDLLYLNGQQLLQEQLSTRRERLYESFREEPGFFQLATAITSNDLEEIQTFLDAAV
NASCEGLIIKTLNRDATYEPAKRSNNWLKLKKDYMDSIGDSLDLVPIAAFHGRGKRVGVY
GAFLLACYDSNNDEYQTICKIGTGFSEAMLEERSTSLRSKVIPKPKSYYRYADTINPDVW
FEPTEVWEVKAADLTISPVYRAAIGAVDPNKGISLRFPRLLRVREDKGPEEASSSDMVAD
MYNAQKHTQHNNQDDNEDE
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgttatcactccggtcatgctgttacagtgcggcttacaccaacgtacactctcgccct
atcggacattctcttcttaaattatctcacccattatcacttccctctccttttctcttt
ctcatacaatctgccaaatactccaacaggatgtcatcgtctcgtccctccgccttcgat
gcactcatgtccaacgctcgtgctgctgctggcaagaaaaagacccagtcgtcttcccct
tcccccaagaaacgaaaaaccctagattcaaaatccccaattaattcgacttcaattagc
gatgctaaacctcccgaagtctcaccaaaacccgagaaaacgttggatgtgaaacaaatc
aaagaagaaagcaatttgtcgaatgggtccaaacaaaatgagccaaaccctaatttggca
tcctccgaggaagaaaaggcctccaagaaaccacgggtgattaatgtggatgaaagtatt
gctcaattgaagaaggcggcagcaaattttgatccccaaaaggcagcgttttggggggaa
ggagaaagagtgccgttcctgtttcttgtcagggtgttcgatgcaatttctaaagagtcg
ggtcggattgtgatcaccggaattgtttgtaatatgctaaggactgtgattaagacaaca
cctgatgatttgcttccggttgtataccttttggccaatagaattgcgccagctcacgag
ggactggagctaggaattggggatgcttccattatcaaggcacttgctgaagcttgtggt
gcaaaagaagcacatattaaaaagcaatacaaggaactgggagatttgggtcttgttgcc
aaagcaagcagatcatcccaacctttgatgcgtaaacctcaaccattgacagttactaaa
gtttttgatacatttcgggttattgccaaggagtctggcaaggatagtcaagataagaag
aaaaatcacatcaagggacttcttgttgcagcaactgactgtgaacctcaatatatgatc
cgtctacttcagacaaaattgcggatcggtttagcagagcaaactctcttgactgccttg
ggacatgcaattttctatactgaaaaacatccatcacctccagtgcacacagattcacct
ctagaagaggctgctaaaattgtgaaacaagtatattctgtaattcccgtgtatgataaa
attgtccctgctcttctttctgatggtgtatggaatctgcccaagacgtgttgcttttca
cccggtgtaccagttggacctatgctagctaagccaactaaaggggtatctgagatttta
gataaatttcaggatatggaattcacttgtgaatacaagtatgatggggaacgggctcag
atacattatatggaggatggcacagttcagatatatagcagaaatgccgaaagaaatacc
gaaaaattccctgatgttgttgttgctgcttcaagagttaaaaaaccaagtgtaacgtcg
tttgttctggactgtgaactggttgcatatgaccacaagaagcaaaaaattctccctttc
cagattctaagcacacgtgctcggaaaaatgtcgtcatgagcgaaatcaaggttgatgta
tgcatctacgcatttgatctgttgtatctaaatggacaacagcttttacaggaacaactt
agtacgcgtagagagcgtctctatgaatccttcagggaagaacctggatttttccagctt
gcaacagccataacatcaaacgatctggaagaaatacaaacattcttggatgctgctgtg
aatgccagttgcgagggattgattatcaaaacattaaatcgggatgctacgtatgagcct
gcaaagcgatcaaataactggctcaagttgaaaaaagactatatggacagtattggtgac
tcgttagatttagtacccattgccgccttccatggccgaggaaagcgtgtaggtgtatat
ggcgcatttctccttgcttgttacgacagtaataatgatgaatatcaaacaatttgcaag
attggcaccggattttcggaagccatgcttgaagagcggtctaccagtcttcgttctaaa
gtgatcccaaagccaaagtcgtactaccggtatgcagatactataaaccccgatgtgtgg
tttgagccaactgaggtttgggaggttaaagctgcagacttgaccatcagccctgtttat
cgtgctgcaattggtgcggttgatcctaataagggcatttcactaagattcccgcgttta
cttcgtgtgcgtgaagataagggtcccgaggaagcttcatcttcagatatggttgctgac
atgtataatgctcagaaacatacccaacataacaatcaagatgacaacgaagatgaatga

DBGET integrated database retrieval system