KEGG   Cynara cardunculus var. scolymus (artichoke): 112520772Help
Entry
112520772         CDS       T05604                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    112520772
Enzymes [BR:ccav01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     112520772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 112520772
NCBI-ProteinID: XP_024985091
LinkDB All DBs
Position
LG 11
AA seq 153 aa AA seqDB search
MVKAVAVLSSSEGVSGTILFSQEAEGAPTTVTGNLSGLKPGPHGFHVHALGDTTNGCMST
GPHYNPHGKEHGAPDDEVRHAGDLGNVTVGEDGSAKFTIVDKQIPLIGSQSIVGRAVVVH
ADPDDLGKGGHELSKSTGNAGGRVACGIIGLQG
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggcagttgcggttcttagcagcagtgagggtgtcagtggcaccatcctattc
agtcaagaggcagaaggtgctcccactactgttactggaaacctttctggcctcaaacct
ggacctcatggtttccatgttcatgcacttggtgacacaaccaatggatgcatgtcaact
ggacctcactacaatccccatggaaaagagcatggcgcacctgatgatgaagttcgccat
gctggtgatcttgggaatgtcacagtaggcgaagatggttctgcaaagttcaccattgtt
gataagcagattccgctaattggatcacaatccattgttggaagggctgtagttgttcat
gcagatcctgatgatcttggaaagggaggccatgagctgagcaaaagcactggaaatgct
ggtggaagagttgcatgtggtatcattggattgcagggttga

DBGET integrated database retrieval system