KEGG   Cynara cardunculus var. scolymus (artichoke): 112521005Help
Entry
112521005         CDS       T05604                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic-like
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00061  Fatty acid biosynthesis
ccav00780  Biotin metabolism
ccav01100  Metabolic pathways
ccav01212  Fatty acid metabolism
Module
ccav_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    112521005
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    112521005
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    112521005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccav01004]
    112521005
Enzymes [BR:ccav01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     112521005
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     112521005
Lipid biosynthesis proteins [BR:ccav01004]
 Fatty acid synthase
  Component type
   112521005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 112521005
NCBI-ProteinID: XP_024985399
LinkDB All DBs
Position
LG 11
AA seq 392 aa AA seqDB search
MMAIGASALQITAARPSIFLTQRSLGVTMAGVVHESDRTFSSKLTSSCHVSSVLKLEKSF
TTSRPRFEKFVTRSMSEASESKSSSQLSIDLKGKRAFIAGIADDNGYGWAIAKSLAAAGA
EILVGTWVPALNIFEMSLRRGKFDGSRVLPDGSLMEITKVYPLDAVFDTPEDVPEDIKAN
KRYAGSSKWTVQEVAESVKQDFGSIDILVHSLANGPEVMKPLLETSRKGYLAAVSASSYS
YVSLLKHFLPIMNPGGSSISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKHK
IRVNTISAGPLGSRAAKAIGFIDTMIDYSFANSPLQKELSADEVGNTAAFLASPLASAIT
GALIYVDNGLNAMGVGVDSPLFKDLNIPTDKH
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaattggtgcttctgccctgcaaataactgctgcaaggccgtccattttcctt
actcaacgaagtctcggggttactatggcaggtgttgtacatgaatctgatagaactttc
tcatctaagcttaccagctcttgtcatgtgtcgtctgtgctaaagcttgagaaaagtttc
acaactagtcgaccacgatttgagaagtttgttacaaggtcaatgtctgaagcttctgaa
agcaagtcttcatcccagctgtccattgatttgaaaggcaaaagggcatttattgctggt
attgctgatgacaatggatatggttgggctattgcaaaatctttagctgctgcaggtgca
gaaattcttgttgggacatgggtgcctgctttaaacatatttgaaatgagcttacggcga
gggaaatttgatggatcacgtgtgttgccagatggttctctgatggagattactaaagtt
tatcctctggatgctgtctttgatacccctgaggatgtacctgaagatataaaagcaaac
aaacgttatgcgggatcaagtaaatggactgtgcaggaagttgcagaatcagtaaagcaa
gactttggtagtattgatattctggtgcactcgcttgccaatgggccagaggttatgaaa
cctctgttggagacatccaggaaaggttatctagctgcagtatctgcatcaagctattct
tatgtttctttgctcaagcatttccttccaattatgaaccccggtggttcctcaatctct
cttacatacattgcttctgagaggatcattccagggtatggtgggggtatgagttcagca
aaagccgcacttgagagtgacaccagagtgcttgcttttgaagcaggaagaaaacataaa
atcagggtcaacaccatatctgcaggtccactgggaagccgtgctgctaaagcaatcggc
ttcatagatacgatgattgattactcttttgcaaattcccccctacagaaagaactatct
gcagatgaagtggggaacactgctgcattcctggcatcaccattggcttctgccattacg
ggtgctcttatatacgtagacaacgggctgaatgcaatgggcgtgggagttgacagtccg
ttgtttaaagatcttaacattccaacggacaaacattag

DBGET integrated database retrieval system