KEGG   Cynara cardunculus var. scolymus (artichoke): 112521905Help
Entry
112521905         CDS       T05604                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00010  Glycolysis / Gluconeogenesis
ccav00030  Pentose phosphate pathway
ccav00051  Fructose and mannose metabolism
ccav00052  Galactose metabolism
ccav01100  Metabolic pathways
ccav01110  Biosynthesis of secondary metabolites
ccav01200  Carbon metabolism
ccav01230  Biosynthesis of amino acids
ccav03018  RNA degradation
Module
ccav_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112521905
   00030 Pentose phosphate pathway
    112521905
   00051 Fructose and mannose metabolism
    112521905
   00052 Galactose metabolism
    112521905
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    112521905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccav01009]
    112521905
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ccav03019]
    112521905
Enzymes [BR:ccav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     112521905
Protein phosphatases and associated proteins [BR:ccav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112521905
Messenger RNA biogenesis [BR:ccav03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     112521905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 112521905
NCBI-ProteinID: XP_024986677
LinkDB All DBs
Position
LG 11
AA seq 463 aa AA seqDB search
MSINDVPPNAEQHPQTLAVDVTLVRLPHLTDYLPHLQTHTTPLEHNNYYSPPDGFYLSHS
DVILRRTIYDLSTNGLYSSHHSAYHRAGPRKQIFYQPQNVRAAIVTCGGLCPGLNTVIRE
LVVGLWEQYGVREIFGIKAGYRGFYSSDPVRIDVKMVHNWHKRGGTVLETSRGGFDLHKI
VNAIEDRGYNQVYIIGGDGTLRGAVKIFNEIHRRKLNVGVAAIPKTVDNDVGIIDRSFGF
QTAVEKAQQAISAAHVEAESAPNGIGLVKLMGRSTGHIALNATLSSRDVDCCLIPENEFY
LEGKGGLFEFLDERLKENGHAVVVVAEGAGQDMIPRTDAQKQEEDESGNPVFLDVGVWLK
SELKRWWERDHEGELFTVKFIDPTYMIRAVTANATDNLYCTLLAHSAVHGIMAGYTGFVA
GPINGNYAYIPMDEIAETKNEVDTKDHNWAWVRSVTMQPDFRS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcaacgacgtcccaccaaacgcagaacaacatccacaaaccctcgccgtcgac
gtaaccctcgtacgccttcctcatctaaccgattaccttccccacctacaaacccacacc
acccctttagaacacaacaactattactctcctcccgacgggttctatctctcccactcc
gacgtcatccttcgccggaccatctacgacctctccaccaacggtctctactcctcccat
cactccgcctaccaccgtgctggaccacgcaaacagatattctaccaaccccaaaacgtg
cgagccgccattgttacttgcggaggcctctgccctggcctcaacaccgttatccgcgag
ctggttgtgggattgtgggagcaatatggagtccgggagatttttggaatcaaggcgggt
tatcgtgggttttattcgtcggatccggttagaattgatgtcaaaatggttcacaactgg
cataagagagggggtaccgtacttgagacctccagaggtggttttgatcttcacaagatc
gtcaatgccattgaagatcgtggatataatcaggtgtacatcattgggggagatggtact
ctccggggagctgttaaaatattcaatgaaatccatcgtcgtaaattgaatgttggtgtt
gccgcaattcccaaaacagtagataacgatgtcggaatcatcgataggtcattcgggttt
cagacagctgttgagaaagcccagcaagccatcagtgcagctcatgtggaggccgagagt
gcacccaatggcatcggccttgttaaactcatgggtcgaagcactggccacattgctctt
aatgcaaccctaagcagtcgcgatgtggactgttgtttgatacccgaaaacgaattttac
ctggagggcaaaggtggtctctttgagtttcttgatgagcgtttgaaagaaaacggtcac
gctgttgtcgtggtggcagaaggagctggacaagacatgataccgagaaccgatgcccag
aaacaggaggaggatgaatctgggaatccagtgtttttagacgtaggggtgtggttgaaa
tcggagttgaagcggtggtgggagagggatcatgaaggtgagttgtttacggtcaagttc
atcgatccgacatacatgattcgtgctgttacagccaatgctacagataatttatattgt
acgttgttggcgcactcggccgttcatggaatcatggcggggtacacggggtttgtagct
ggtccgattaacggaaactatgcatacattcccatggatgagattgctgagaccaaaaat
gaagtggacaccaaagatcacaactgggcatgggtgagatctgtgacgatgcagcctgat
tttcggtcgtga

DBGET integrated database retrieval system