KEGG   Cynara cardunculus var. scolymus (artichoke): 112524446Help
Entry
112524446         CDS       T05604                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial-like isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00564  Glycerophospholipid metabolism
ccav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    112524446
Enzymes [BR:ccav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     112524446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox Pyr_redox_2 FAD_binding_3 Pyr_redox_3 GIDA Lycopene_cycl NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 112524446
NCBI-ProteinID: XP_024990032
LinkDB All DBs
Position
LG 13
AA seq 633 aa AA seqDB search
MASFFGARRVGVTAATLAVAVGGSYVALRDPYVSSSDXAGGGXALEAXRRKITDPXAVVP
SRAVQESYLVAANSSNPLDILVVGGGATGCGVALDAVTRGLRVGLVERDDFSSGTSSRST
KLIHGGVRYLEKAVFNLDYGQLKLVFHALEERKQVIDNAPHLCHALPCMTPCFSWFEALY
YWVGLKMYDLVAGRRLLHLSRYYSAQESAELFPTLARKGKDRSLKGTVVYYDGQMNDARV
NVGLACTAALAGAAVLNHAEVVSLLKEDGGNRIIGARIRDNLSGTEFDAYAKVVVNAGGP
FCDSVRKLADKDAKPIICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVA
GTTDSSTSITMLPEPHEDEIEFILDAICDYLNVKVRRTDVLSAWSGIRPLATDPNAKNTE
SISRDHVVCEDFPGLVTITGGKWTTYRSMAEDAVNAAIKSGKLNAANSSLTSNIRLVGGD
GWDPAFFTVLAQEYVRMKVGHSGKIVPGVMDTAAAKHLSHSYGTMAERVAVIAQNENLGK
RLAHGYPYLEAEVAYCARNEYCESAVDFIARRSRLAFLDTDAAGRALPRVIEILAAEHHW
DKRRQKQESETATKFLESFKSSKNAQFHDGKHT
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtttttttggcgctcggcgcgtaggcgtaaccgccgctacactcgctgtcgct
gtaggcggctcctacgtggcactccgtgacccytaygtctcctccagcgacstcgcyggy
ggaggywcagcsctagaggcartccggaggaaaatcacmgacccsgywgcggttgtacct
tctcgtgccgtacaagagtcatatctcgtcgctgctaattcctctaatccactcgacatt
ctcgttgtcggtggaggcgccaccggatgcggggtcgctctcgatgccgtcaccagaggg
ctacgtgtcggccttgtggaacgagatgacttctcttctggaacgtcatcccgctctacg
aagttaattcacggaggtgttcgctacttggaaaaagcggtattcaatttagattatggg
caactaaagctggtttttcatgcattagaggagcgcaaacaggttattgataatgctccg
cacctgtgccatgctttaccttgcatgacaccatgttttagctggtttgaggcactatac
tattgggtgggcttgaaaatgtatgatctggtggcaggacgacgtctacttcatctatcc
aggtactattctgcacaagagtctgctgaactcttccccacacttgcaaggaaaggcaaa
gatagaagtttgaagggaacagtagtctattatgatggacaaatgaatgatgcacgggtt
aatgttggcttagcatgcactgctgcattagcaggagccgctgtacttaatcatgccgaa
gttgtatcccttcttaaagaagatggtgggaatcggataataggagcacggattcgggac
aatttatcaggcacggagtttgatgcatatgcaaaagtagtagttaatgcgggtggacca
ttttgcgactctgttagaaaattggctgataaagatgcaaaaccaattatctgtcctagc
agtggtgtccacattgttctgcctgactattattctcctgagggaatgggcttgattgtt
cccaagacaaaggacggacgtgttgtattcatgctcccatggttaggaaggacggttgct
ggtacaaccgactccagtacgagcattaccatgctaccagaacctcatgaggatgaaatt
gaatttatactggatgccatctgtgattatcttaatgttaaggtacggcgcacagatgtt
ctctctgcttggagtggaatccggcctttggcaactgatccaaatgcgaagaacacagag
agcatttcaagggatcatgttgtgtgcgaagattttcctggtttggtcacgattactggt
ggaaagtggaccacatatagaagcatggctgaagatgcagtcaatgcagctatcaagtct
ggaaagctgaacgcagcaaacagcagtttgacgtccaacatacgtctagtgggtggagat
ggatgggatccagcatttttcaccgtgcttgctcaagaatatgtgcgaatgaaggtggga
catagtggtaaaattgttcctggagttatggatactgctgctgctaagcatttgtctcat
tcatatggtaccatggctgaaagagtagctgtcatagcacagaatgaaaatcttggcaag
cggcttgcccatgggtacccataccttgaagctgaggttgcttattgtgctcgaaatgag
tactgtgaatctgcagtagatttcattgctagaagatcccgacttgcttttctcgatact
gatgcagcaggccgagcactgccccgtgtgattgagatattggcggctgagcaccattgg
gacaagcgaaggcagaagcaagagtccgagacagcaacaaagtttcttgaatctttcaag
tcatcaaagaatgctcaatttcatgatgggaagcatacataa

DBGET integrated database retrieval system