KEGG   Cynara cardunculus var. scolymus (artichoke): 112525224Help
Entry
112525224         CDS       T05604                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00010  Glycolysis / Gluconeogenesis
ccav00020  Citrate cycle (TCA cycle)
ccav00620  Pyruvate metabolism
ccav01100  Metabolic pathways
ccav01110  Biosynthesis of secondary metabolites
ccav01200  Carbon metabolism
Module
ccav_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112525224
   00020 Citrate cycle (TCA cycle)
    112525224
   00620 Pyruvate metabolism
    112525224
Enzymes [BR:ccav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     112525224
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 112525224
NCBI-ProteinID: XP_024991021
LinkDB All DBs
Position
LG 13
AA seq 482 aa AA seqDB search
MSSSLLQSRVPTALSFSSSIAGGTKPQWRFTSAPAVTFTRRTRNSTIHAKIREIFMPALS
STMTEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVAEGESAPVGA
PIGLLAETEAEIEEAKAKAAGAGSSAPSTPAASAPSPPPPPAPVAAAPTPVAAPVAADGP
RKIVSTPFAKKLAKQHKVDINKLVGTGPFGRITPADVEAAAGIAPAKSSAAPVTAAAHAP
AAAAAAAPAKSAPTFAEIPGATIVPFTTMQAAVSKNMIESLSVPTFRVGYPIITDALDAL
YEKVKPKGVTMTALLAKAAAMALVQHPVVNASCKDGKSFTYNSSINIAVAVAINGGLITP
VLPDADKLDLYLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQ
GAIMAVGASKPTAVADKDGYFSVKSQMLVNVTADHRIVYGADLAAFLKTFAKIVQEPDSL
TM
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctctcttcttcaatctagggttcccaccgcactctctttctcttcatctatc
gccggcggcactaaaccccaatggcgctttacctccgcacctgccgttacatttactcgc
cgcaccaggaattccaccatccatgctaaaatcagagagatcttcatgcctgcactcagc
tccaccatgactgagggcaagatcgtgtcttggatcaagtccgaaggcgatgttctttcc
aagggggagtccgttgtcgttgttgaatctgataaggctgatatggatgtcgaaactttt
tacgatggaattcttgccgctattgttgtcgctgagggtgaatcggctccagtcggtgct
cccattggtttattagcggaaactgaagctgaaattgaagaagctaaagcgaaagccgct
ggtgctggtagttcagctccctccacgcctgctgcttccgctccttctccgccaccgcca
ccggctccggttgctgccgctcctacaccagttgcggcccctgttgcggccgatggaccg
aggaagattgtttcgacaccttttgctaagaagctggcgaaacagcacaaggttgatata
aataagttggttgggactgggccctttgggaggattactcctgcagatgttgaagcagct
gccggaatcgcccctgcaaaaagctcagccgcccctgtaactgctgctgctcatgcccct
gcggcagcagctgctgctgccccggctaaatccgcacccacatttgctgaaattcctggg
gcaactattgttccatttaccacaatgcaagctgcggtctcaaagaacatgattgaaagc
ttgtctgtgccaaccttccgtgttggttacccgattataacagacgctcttgatgctcta
tatgagaaggtcaagcctaagggtgttaccatgaccgctttgctagcaaaggctgctgct
atggcccttgttcagcaccctgttgtaaatgcaagttgcaaagatggaaagagctttact
tataacagtagcatcaatattgctgtggctgtggctatcaatggcggtttgattacccct
gttcttccagatgctgacaagttggatctttatctgttatcccaaaaatggaaggagctt
gtggagaaagcacggtcgaagcaacttcagccccatgagtacaactcagggacttttact
ctatccaacttgggcatgtttggagtggatcgcttcgacgctattcttcctcctggacag
ggggctattatggctgttggagcttcaaagcctactgctgttgctgataaagatggatat
ttcagcgtgaaaagtcaaatgctggtaaatgttaccgctgatcaccgaattgtatatgga
gcggacttggctgctttccttaaaacattcgcaaagattgttcaagaacccgacagcttg
acgatgtaa

DBGET integrated database retrieval system