KEGG   Clostridium cellulovorans: Clocel_0582Help
Entry
Clocel_0582       CDS       T01294                                 

Definition
(GenBank) ABC transporter related
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
ccb  Clostridium cellulovorans
Brite
KEGG Orthology (KO) [BR:ccb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccb02000]
    Clocel_0582
Transporters [BR:ccb02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    Clocel_0582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase AAA_30 AAA_22 PhoH ATPase_2 AAA_23 AAA_19 NB-ARC AAA_18 RNA_helicase T2SSE cobW NACHT Rad17 AAA_29 AAA_24 AAA AAA_16 PduV-EutP AAA_15 NTPase_1 KAP_NTPase AAA_33 ATP_bind_1 TsaE
Motif
Other DBs
NCBI-ProteinID: ADL50353
UniProt: D9SR65
LinkDB All DBs
Position
722302..723003
Genome map
AA seq 233 aa AA seqDB search
MKSILEIENLSKSFSRRKALDGISLNLENSKVLGLIGPAGSGKTTLINIIAGLAKQDQGT
IKIDDHEPGVYTKEIVSYLPQGNHLHNWMTVKEEIGFFQDFYKDFDKKKAENLLSDMNID
GKIKVGNLSKDNLEKLKLTLIFSRKAKLYLLDEPFSGADSLVRDEIIDIILRSYDEESSV
ILSSKDAKIFERLVDKVAFISGGKILLSGDPEDLRHERRMSIDDLYREVIKNV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtctattttagaaatagaaaatttatctaagagtttttcaagaagaaaagcttta
gatggtataagtcttaatttagaaaatagtaaggttcttggactaatcggaccagctggg
agcggaaaaactactttaattaatataatagctgggcttgctaaacaagaccaaggaaca
attaaaatagatgaccatgaaccaggagtatatacaaaagagatagtttcttatctacct
caaggaaatcatcttcacaactggatgactgtaaaagaagaaatcggatttttccaagac
ttttataaagactttgataagaaaaaggcagaaaatctgcttagtgacatgaatattgat
ggaaaaatcaaggttggaaatctttcaaaggataatcttgaaaagttaaagcttacttta
atattttcaagaaaagcaaaattgtacctgttagatgagccttttagtggtgctgattca
ttagtaagggatgagataatagatataattttaagaagctatgatgaagaaagctcagta
attctttcttctaaggatgctaaaatttttgaaagattagtagataaagttgcttttatt
tcaggtggaaaaattcttttaagtggagatccagaagatcttagacatgaaagaagaatg
tcaattgatgatttatacagggaggtaattaaaaatgtttaa

DBGET integrated database retrieval system