KEGG   Clostridium cellulovorans: Clocel_1149Help
Entry
Clocel_1149       CDS       T01294                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccb  Clostridium cellulovorans
Pathway
ccb00620  Pyruvate metabolism
ccb00680  Methane metabolism
ccb01100  Metabolic pathways
ccb01120  Microbial metabolism in diverse environments
ccb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Clocel_1149
  09102 Energy metabolism
   00680 Methane metabolism
    Clocel_1149
Enzymes [BR:ccb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Clocel_1149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 PEPcase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADL50905
UniProt: D9SUK0
LinkDB All DBs
Position
1388168..1389784
Genome map
AA seq 538 aa AA seqDB search
MRKYPRSMATQHPDNADKYITIQQEPEEAIGMLTPQEKGGLGIEEIMIDFEGKLTPYHQT
SQIALGLIGNGVIPGRDVAITPRIPNAKKESVFRQLISIMSLVETNILASEHGVEQVIRE
TIVPMIETGEEIVQIQERINSVIELGNKNYTNKFDPNSIRVIPLIESVPALIDVDNILDE
YYQNSLKNGHKIESQRVMFARSDSAMSYGMVSSVLSVLIAINKAHKWGAKNSVDIAPIVG
CGSLPFRGHLTEESLGDLYETYAGVRTFTIQSGLRYDYGAEKTKAVVNSLNENIQNTKPR
DFSEEDIELMYEIIGIFAKYYLQTFTKFISTVDFISKYIPKNRDRLASTKVGLQYVREAA
NVKEIADLVKDEKLKEEILSINTEIQCNVPRAISFTAAMYTIGLPPEFIGVGRGLQEVKE
KFGQEGIDKLVEFYPQLKTDLLFAWRYVNAVGAKGIIPEEARSEYKEDFALAMELLNLVN
EIDEKDKNEFYHTLLKSTRPIIMHLVGKEEDMFDSGEEEQKILREWIVKMGKIRGSLG
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatatccaagatccatggcaacgcagcatccagataatgcggacaagtatatt
actatccaacaagaaccagaagaagccataggaatgttaactcctcaagaaaagggtgga
ttaggtattgaagaaatcatgatagatttcgaaggaaagcttacgccataccatcaaaca
tctcaaatagcattaggactaataggtaatggggtaattcctggaagagatgtagctata
acaccaagaataccaaatgctaaaaaagaatctgtttttagacaattaattagcattatg
tcattggtagaaacaaatattcttgcatcagaacatggcgtagagcaagttataagagaa
actattgtaccaatgattgaaacaggagaagaaattgtacaaattcaagaaagaattaat
tctgttattgaacttggaaacaaaaattatactaacaaatttgatccaaatagtataaga
gtaattcctcttatagaaagtgtaccagcattaatagatgtagataatattttagatgaa
tattatcaaaattctcttaaaaatggtcataaaatagagagccaaagagtaatgtttgct
agatcagattctgctatgtcatatggtatggtttcatcagttttatctgtattaatagca
ataaacaaagctcataaatggggagcaaaaaacagtgttgatatagcaccaattgttggt
tgtggttcattaccatttagaggacatcttactgaagaaagcttaggagatttatatgaa
acttatgctggagtaagaactttcacaatacaatcaggcttaagatatgattatggtgca
gaaaagacgaaagctgttgtaaatagtttaaatgaaaatattcaaaatactaaaccaaga
gatttctcagaagaagatatagaattaatgtacgagattataggaatatttgctaagtat
tacctacaaacatttactaagttcattagtactgttgatttcatttcaaagtatatccct
aaaaacagagatagattagcaagtactaaagtaggtttacaatatgtaagagaagcagct
aatgttaaagaaattgctgacttagttaaagatgaaaagcttaaggaagaaattttaagt
ataaatacagaaattcaatgtaacgtaccaagagctatttcctttacagctgcgatgtat
acaataggcttacctccagaattcataggtgtaggaagaggcttacaagaagttaaggaa
aaattcggacaagaaggaattgataagcttgttgaattctatcctcaattaaagacagat
ttactatttgcatggagatacgtaaatgctgtaggagcaaaaggaataattccagaagaa
gctcgttcagagtataaggaagatttcgctttagctatggaattattaaatctagtaaat
gaaatagatgaaaaagataaaaatgaattctatcatacattattaaaatcaactagacct
ataatcatgcatttagtgggaaaagaagaagatatgtttgatagtggtgaagaagagcag
aagattttaagagaatggattgttaagatgggtaaaattagaggtagtctaggctaa

DBGET integrated database retrieval system