KEGG   Clostridium cellulovorans: Clocel_1214Help
Entry
Clocel_1214       CDS       T01294                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ccb  Clostridium cellulovorans
Pathway
ccb00473  D-Alanine metabolism
ccb00550  Peptidoglycan biosynthesis
ccb01100  Metabolic pathways
ccb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ccb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Clocel_1214
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Clocel_1214
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Clocel_1214
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ccb01011]
    Clocel_1214
Enzymes [BR:ccb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Clocel_1214
Peptidoglycan biosynthesis and degradation proteins [BR:ccb01011]
 Precursor biosynthesis
  Amino acid ligase
   Clocel_1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp RimK CPSase_L_D2 GARS_A ATPgrasp_ST ATPgrasp_TupA ATP-grasp_4 R2K_2
Motif
Other DBs
NCBI-ProteinID: ADL50970
UniProt: D9SUR5
LinkDB All DBs
Position
1486631..1487527
Genome map
AA seq 298 aa AA seqDB search
MKVGVIMGGISSERAVSLKSGEEVVKYLNRNKYEVIPIVIDSKKQVVEKVQGIDFAFIAL
HGKFGEDGTIQGILEALEIPYSGCSVLTSAICMNKGITKSLLQNANINTAPWITVKSVEE
IDYEKIKSLGYPVFIKPNNGGSSVATFCVKDEGEVEKAVKEGLKYDTEVMIEKYIKGEEI
TSFILNGEVFPTVMIETKSSGFFDYTAKYDDNGAEENVVYLKEQLQSQVAEISKKIWDLL
YCRSYSRVDMIISNGIPYVLEVNTLPGLTPHSLIPKSAKAKGMEFSELLDKIIKYSLV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcggagtaattatgggtggaatttcatcagaaagagcagtatcactaaagtct
ggggaagaagtagtaaaatatttaaatagaaataagtacgaggttattcctatagtaata
gattctaaaaagcaggtagtagaaaaagttcaaggaattgattttgcttttatagctttg
cacggaaagtttggggaggatggtacaattcaaggaattcttgaagctttagagattcct
tatagtggctgcagcgtattaactagtgccatttgtatgaacaaaggcataacaaagagt
cttcttcaaaatgctaatataaatacagcaccttggattaccgttaaatctgtagaggaa
atcgattatgaaaagataaaaagtcttggatatcctgtatttattaaacctaacaatgga
ggatctagtgttgcaaccttttgtgtaaaagatgaaggggaagtagaaaaggctgttaaa
gaaggtctaaaatatgatacagaggtaatgatagaaaagtatataaaaggagaagaaatc
acttcttttatattgaatggagaagtttttccaacagtgatgatagaaacgaaaagctca
ggattctttgactacacagctaaatatgatgataatggtgcagaggaaaatgtagtatat
ttaaaagaacaattgcaatcacaagtagcggagatttctaagaaaatttgggatttgtta
tattgcagaagctactcaagagttgatatgataataagtaacggaattccttatgtttta
gaagttaataccttgccgggacttactcctcacagtttaattcccaaaagtgctaaagca
aagggaatggaatttagtgaattgttagataaaattataaaatattcccttgtttag

DBGET integrated database retrieval system