KEGG   Clostridium cellulovorans: Clocel_1265Help
Entry
Clocel_1265       CDS       T01294                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ccb  Clostridium cellulovorans
Pathway
ccb00473  D-Alanine metabolism
ccb01100  Metabolic pathways
ccb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Clocel_1265
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Clocel_1265
Enzymes [BR:ccb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Clocel_1265
Peptidoglycan biosynthesis and degradation proteins [BR:ccb01011]
 Precursor biosynthesis
  Racemase
   Clocel_1265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADL51020
UniProt: D9SUW5
LinkDB All DBs
Position
1544909..1546069
Genome map
AA seq 386 aa AA seqDB search
MFKHIRPVWAEINLDNLAHNMREIKKITRAKDIIAVVKADGYGHGAIDTSKILLENGATA
LAVAVISEAVELRRNGIKCPIMILGYTPTIYGDSLVKYDISPTVFTYEYAKELSDIAKAE
DKIIKIQVALDTGMGRIGFMPDKNSVEEVYKISKLPNISIEGIFSHFSTSDEANKKFTLE
QLKKYEDFIHNLEERGINIKIRHIANSAAIIDLKDTHFEAVRSGIIMYGYYPSKEVNVSK
LLLKPVMTLKTNIIHVKKLPKDYSISYGRTYKTQKEEIIATLPVGYADGYTRQLSDKAQV
IINGKLAPVVGRICMDQCMVNVTDIDDVKIGDEVILMGQCDNVKMDADDIAGLLETINYE
VVCMIGKRVPRVYIQDNKVIKIRNYV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaacatatcagaccagtttgggcagagataaatttagataatttagctcataat
atgagagagataaagaaaataacaagagcaaaggatattattgctgtagttaaggctgat
ggatatggtcatggagctattgatactagtaagatacttttagagaatggtgctacagct
ttagctgtagctgtaataagtgaggctgtagagctaagacgcaatggtataaaatgtcct
ataatgatacttggatatactccaactatctatggagatagccttgttaaatatgacata
tctcctactgtttttacttatgaatatgctaaggaactttctgatattgctaaggcggaa
gataaaataataaaaatacaggtagctttagatactggtatggggagaattggatttatg
cctgataaaaatagtgtagaagaggtatataaaatctccaagttacctaatatatcgata
gagggtattttttcacacttctcaacttcagatgaagctaataagaaatttaccttagaa
cagttaaaaaaatatgaagattttattcataacctagaagaaagaggcataaatattaaa
ataagacatattgcaaatagcgctgcaataatagacttaaaggatacgcattttgaagca
gtacgctcagggataataatgtatggctactatccttcaaaggaggtcaatgtatcaaaa
ctgttgctaaaacccgttatgactctaaagacaaacataatacacgtaaaaaagttaccc
aaagattattcaattagttatggaagaacctacaaaacacaaaaagaagagataatagca
acactgccagtaggttatgctgatggttatactcgtcagctatcagataaagcacaagta
ataatcaatgggaaattagctccagtagttgggagaatttgcatggaccaatgtatggtt
aatgtcacagatattgatgatgttaagattggcgatgaagtcatactaatgggacagtgt
gataatgtgaaaatggatgctgacgacatagcaggactcttagaaactataaattatgaa
gtggtatgcatgatagggaaacgtgttccacgagtatacatacaagataataaagtcata
aaaataaggaattatgtatag

DBGET integrated database retrieval system