KEGG   Clostridium cellulovorans: Clocel_1516Help
Entry
Clocel_1516       CDS       T01294                                 

Definition
(GenBank) carbon-monoxide dehydrogenase, catalytic subunit
  KO
K00198  anaerobic carbon-monoxide dehydrogenase catalytic subunit [EC:1.2.7.4]
Organism
ccb  Clostridium cellulovorans
Pathway
ccb00633  Nitrotoluene degradation
ccb00680  Methane metabolism
ccb01100  Metabolic pathways
ccb01120  Microbial metabolism in diverse environments
ccb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccb00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Clocel_1516
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Clocel_1516
Enzymes [BR:ccb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.4  anaerobic carbon-monoxide dehydrogenase
     Clocel_1516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prismane
Motif
Other DBs
NCBI-ProteinID: ADL51265
UniProt: D9SWC1
LinkDB All DBs
Position
complement(1865062..1866981)
Genome map
AA seq 639 aa AA seqDB search
MSETILEKTEGRVSYHDSVEEMLKRIREDGMSNVFDRYALQEKIRCKFCLEGLSCQLCSN
GPCRISEKTGQDKGVCGIGNDAMAMRNFLMQNVMGAGTYSHHAYEAFRTLKATAEGKTPF
QITDVGKLTWMCEKVGISTSQDVNQMARELAIFLEGQQHIGIEEKNVMVEAFAPKKRIER
WKEIDIYPCGTIHEEQNCIASCLTNVDGNHVSLAMKALRLGIATIYNSQIGLEMVQDILF
GTPKPHEANMDLGIMDPDYINVVFNGHQPWPGVATLLKARTKEVQDMAKAAGAKGLRIVG
SIETGQELLQRFEVDDVFVGHMGNWLTIEPLLATGTVDVFAMEENCSPPAIDMYAEKYQI
TLVAVSTIIDLPGIKYKIPYDPTEVDQMADELINLAIENFKKRKERKIVPKVPQKIQKAI
TGFSTEAVLGALGNKLDPLVQVISEGKIKGVVALANCSTLRNGPQDWVTVNLTKELIKKD
ILVVAGGCGNHALEVAGLCTLEAANEIAGEGLKAVCNLLKIPPVLSFGTCTDTGRISMLV
TALAEHLNVDVPDLPIAVTAPEWMEQKATIDGVFALAYGTYTHLSPVPFMTGAPELVALL
TEKAKGVTGGNIALGDDPVQVAKNIEAHIIEKRKALGLN
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaactatattagaaaaaacagaaggaagagttagctatcacgattctgttgag
gaaatgcttaagagaatccgggaagacggaatgtctaatgtattcgatagatatgcctta
caagaaaaaataagatgtaaattctgtctcgaaggattaagctgtcagctctgctctaat
ggtccatgtagaatcagtgaaaaaactggtcaagacaaaggggtttgtggaatcggcaac
gatgccatggcaatgagaaatttcttaatgcaaaatgtaatgggcgcaggtacatatagt
catcatgcctatgaagctttccgtactctaaaagcaacagcagaagggaaaactccattc
caaatcaccgacgttggcaaacttacttggatgtgcgaaaaagtaggtataagcacaagt
caagatgtaaatcaaatggctcgtgaacttgcgattttccttgaaggccaacaacatatc
ggtattgaagaaaaaaatgtaatggttgaagcctttgctcctaaaaaacgtatagaacgt
tggaaggaaatagatatatatccttgtggcactatccacgaagaacaaaactgcattgcc
agctgcttaactaatgttgacggcaaccatgtatccttagctatgaaagccttgagactt
ggaatagcaaccatctataatagccagattggtttagaaatggttcaagatattttattt
ggaacaccaaaaccacatgaagctaacatggaccttggcataatggatccagactacata
aatgtagttttcaatggacaccaaccttggccaggagttgctacacttttaaaagctaga
acaaaagaagttcaagatatggcaaaggctgctggggcaaaaggacttagaattgttggt
tcgatagaaacaggtcaagaattacttcaaagatttgaagttgacgatgtgtttgtagga
catatgggcaattggcttacaatagaaccactattagctacaggcaccgtggacgtcttt
gctatggaagaaaactgttctccacctgctatagatatgtacgctgaaaaatatcaaata
actttagttgccgtaagcactattatcgatcttccaggaattaaatataaaataccttac
gacccaacagaggttgatcaaatggcagacgaattgattaatcttgctattgaaaacttt
aaaaagagaaaggaaagaaagatagttccaaaggttcctcaaaaaatacaaaaggcaata
actggtttctccacagaagcagttctaggagctcttggcaacaagcttgatcctcttgtt
caagttatatcagaaggaaaaatcaaaggagttgtagcccttgcaaattgctccactcta
agaaatggacctcaagattgggttacagtaaatctaacaaaagaactgattaaaaaagat
atcctagttgttgctggtggttgcggaaaccatgctctagaggttgcaggtctttgtacc
cttgaagctgctaatgaaatagctggagaaggcttaaaagctgtatgtaatctgttaaaa
atccctccagtattaagctttggtacttgcactgatactggaagaatctcaatgcttgta
actgcactggctgaacatttgaatgtagatgttcctgaccttccaatagccgttacagca
ccagaatggatggaacaaaaggcaactatagatggagtcttcgccttagcttacggtact
tatactcatttatctccagtaccgtttatgactggagctccagaacttgtagctttatta
actgaaaaagcaaagggtgtaactggcggaaacatagcccttggtgatgatcctgttcaa
gtagccaaaaacattgaagctcatattattgaaaagagaaaagctcttggattgaattaa

DBGET integrated database retrieval system